Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.97
PubTator Score 11.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Disease Progression 125
Disease Target Count P-value
Breast cancer 3099 2.11918397784125E-33
osteosarcoma 7933 1.06479442122975E-6
psoriasis 6685 3.80112259975079E-5
ovarian cancer 8492 9.67404969576461E-5
lung cancer 4473 1.97442703799584E-4
glioblastoma 5572 2.22345483509213E-4
medulloblastoma, large-cell 6234 0.00160325631509192
astrocytoma 1493 0.0250840119808903
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Intestinal tuberculosis 5 3.514 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 2.700 0.000
osteosarcoma -2.038 0.000
astrocytoma 1.100 0.025
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.100 0.002
lung cancer 1.800 0.000
Breast cancer -1.600 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q9UG63 O60864 Q75MJ0 Q75MJ1 Q96TE8
Symbols ABC28
HUSSY18
HUSSY-18
EST133090

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

 GO Process (1)

Gene RIF (6)

PMID Text
22252987 Overexpression of ABCF2 suppressed RVD.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19002184 Among cervical cancer cases, 149 (55.8%) expressed ABCF2. The overall survival was longer in ABCF2-negative than ABCF2-positive cases
16996567 Data suggest that ABCF2 protein may be a candidate marker for clear cell adenocarcinomas of the ovary and the uterine corpus and may be important for the pathogenesis of these diseases.
16203778 ABCF2 may have a role in progression of clear cell ovarian adenocarcinomas

AA Sequence

MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAA      1 - 70
RAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE     71 - 140
HIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASR    141 - 210
ILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVL    211 - 280
VSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSA    281 - 350
KLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGI    351 - 420
DLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEI    421 - 490
KEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAIN    491 - 560
EFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV           561 - 623
//

Text Mined References (25)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22252987 2012 Involvements of the ABC protein ABCF2 and ?-actinin-4 in regulation of cell volume and anion channels in human epithelial cells.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
More...