Property Summary

NCBI Gene PubMed Count 21
PubMed Score 9.81
PubTator Score 11.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 2.1e-33
osteosarcoma 7950 1.1e-06
ovarian cancer 8520 9.7e-05
glioblastoma 5792 2.2e-04
psoriasis 6694 5.8e-04
medulloblastoma, large-cell 6241 1.6e-03
astrocytoma 1146 2.5e-02
lung cancer 4740 4.2e-02
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Intestinal tuberculosis 5 3.508 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 2.5e-02
Breast cancer -1.600 2.1e-33
glioblastoma 1.100 2.2e-04
lung cancer 1.500 4.2e-02
medulloblastoma, large-cell 1.100 1.6e-03
osteosarcoma -2.038 1.1e-06
ovarian cancer -1.700 9.7e-05
psoriasis 1.400 5.8e-04

 GO Process (1)

Gene RIF (7)

AA Sequence

MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAA      1 - 70
RAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE     71 - 140
HIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASR    141 - 210
ILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVL    211 - 280
VSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSA    281 - 350
KLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGI    351 - 420
DLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEI    421 - 490
KEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAIN    491 - 560
EFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV           561 - 623
//

Text Mined References (26)

PMID Year Title