Property Summary

NCBI Gene PubMed Count 20
Grant Count 29
R01 Count 26
Funding $5,385,530.48
PubMed Score 89.42
PubTator Score 19.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -2.050 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.100 0.022
subependymal giant cell astrocytoma -1.570 0.013
invasive ductal carcinoma -1.100 0.038

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17478478 High-throughput mass spectrometry screening for inhibitors of PISD is reported.

AA Sequence

MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPARTMFLLRPLPIL      1 - 70
LVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVY     71 - 140
SLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSVISPSDGRILNFGQVKNCEVEQVKG    141 - 210
VTYSLESFLGPRMCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHF    211 - 280
PGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYN    281 - 350
DFSFVTHTNREGVPMRKGEHLGEFNLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL               351 - 409
//

Text Mined References (21)

PMID Year Title
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19165886 2009 Phosphatidylserine decarboxylases, key enzymes of lipid metabolism.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17478478 2007 High-throughput mass spectrometry screening for inhibitors of phosphatidylserine decarboxylase.
16381901 2006 The LIFEdb database in 2006.
16192276 2005 Disruption of the phosphatidylserine decarboxylase gene in mice causes embryonic lethality and mitochondrial defects.
More...