Property Summary

NCBI Gene PubMed Count 20
PubMed Score 94.13
PubTator Score 19.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.5e-06
invasive ductal carcinoma -1.100 3.8e-02
medulloblastoma, large-cell -1.100 2.2e-02
osteosarcoma -2.050 1.2e-07
psoriasis -1.600 5.2e-05
subependymal giant cell astrocytoma -1.570 1.3e-02

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPARTMFLLRPLPIL      1 - 70
LVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVY     71 - 140
SLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSVISPSDGRILNFGQVKNCEVEQVKG    141 - 210
VTYSLESFLGPRMCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHF    211 - 280
PGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYN    281 - 350
DFSFVTHTNREGVPMRKGEHLGEFNLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL               351 - 409
//

Text Mined References (21)

PMID Year Title