Property Summary

NCBI Gene PubMed Count 23
PubMed Score 10.41
PubTator Score 13.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 4.0174881320746E-7
medulloblastoma, large-cell 6234 1.50661756538937E-6
ovarian cancer 8492 9.63644186806489E-6
glioblastoma 5572 1.42912253433912E-5
osteosarcoma 7933 1.09510437834584E-4
group 4 medulloblastoma 1875 0.0029349950345309
primary pancreatic ductal adenocarcinoma 1271 0.00340064659573921
Breast cancer 3099 0.0248609387717636
spina bifida 1064 0.0384032959179552
Disease Target Count Z-score Confidence
Fragile X syndrome 31 3.449 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.130 0.000
group 4 medulloblastoma 1.700 0.003
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.600 0.000
medulloblastoma, large-cell 1.800 0.000
primary pancreatic ductal adenocarcinoma 1.094 0.003
Breast cancer 3.600 0.025
spina bifida -1.223 0.038
ovarian cancer -1.700 0.000

Synonym

Accession Q9UFW8 D3DU38 O15183 CGG-binding protein 1
Symbols CGGBP
p20-CGGBP

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
26482656 CGGBP1 protein play an important cytoprotective role in patients with cancer.
25981527 CGGBP1 is a possible bidirectional regulator of CpG methylation at Alus, and acts as a repressor of methylation at L1 retrotransposons.
24491049 Over-expression of miR-7 could significantly inhibit the growth of human lung cancer cells in vivo and in vitro, which might be related to the down-regulated expression of tumor growth-associated protein CGGBP1
24196442 Our results suggest that CGGBP1 phosphorylation at S164 is a novel telomere protection signal, which can affect telomere-protective function of the shelterin complex
21733196 CGGBP1 depletion by RNA interference in tumor-derived cells caused an increase in the cell population at G0/G1 phase and reduced the number of cells in the S phase.
20141036 CGGBP-20 downregulates the activity of 5'-region of FMR1 gene in the presence of GCC-triplets only.
19728537 Differences in factors implicated in CGG repeat instability--CGG repeat size, XS548/FRAXAC1 haplotypes, and AGG interspersion pattern-are present in the Basque populations analyzed.
14667814 CGGBP1 was mapped to chromosome 3p and a sequence of 235 nucleotides 5' upstream of CGGBP1 is essential for promoter activity.

AA Sequence

MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR      1 - 70
KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI     71 - 140
PKSDQLRRAYLPDGYENENQLLNSQDC                                               141 - 167
//

Text Mined References (27)

PMID Year Title
26482656 2015 CGGBP1--an indispensable protein with ubiquitous cytoprotective functions.
25981527 2015 CGGBP1 mitigates cytosine methylation at repetitive DNA sequences.
25416956 2014 A proteome-scale map of the human interactome network.
24491049 2014 [Over-expressed microRNA-7 inhibits the growth of human lung cancer cells via suppressing CGGBP1 expression].
24196442 2014 CGGBP1 phosphorylation constitutes a telomere-protection signal.
21733196 2011 CGGBP1 regulates cell cycle in cancer cells.
21269460 2011 Initial characterization of the human central proteome.
20141036 2009 [The role of ZF5 and CGGBP-20 transcription factors in expression regulation of human FMR1 gene responsible for X-fragile syndrome].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19728537 2008 Fragile X gene stability in Basque Valleys: prevalence of premutation and intermediate alleles.
More...