Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $74,909.67
PubMed Score 10.41
PubTator Score 13.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.130 0.000
group 4 medulloblastoma 1.700 0.003
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.600 0.000
medulloblastoma, large-cell 1.800 0.000
primary pancreatic ductal adenocarcinoma 1.094 0.003
Breast cancer 3.600 0.025
spina bifida -1.223 0.038
ovarian cancer -1.700 0.000

Synonym

Accession Q9UFW8 D3DU38 O15183 CGG-binding protein 1
Symbols CGGBP
p20-CGGBP

Gene

 Grant Application (2)

Gene RIF (8)

PMID Text
26482656 CGGBP1 protein play an important cytoprotective role in patients with cancer.
25981527 CGGBP1 is a possible bidirectional regulator of CpG methylation at Alus, and acts as a repressor of methylation at L1 retrotransposons.
24491049 Over-expression of miR-7 could significantly inhibit the growth of human lung cancer cells in vivo and in vitro, which might be related to the down-regulated expression of tumor growth-associated protein CGGBP1
24196442 Our results suggest that CGGBP1 phosphorylation at S164 is a novel telomere protection signal, which can affect telomere-protective function of the shelterin complex
21733196 CGGBP1 depletion by RNA interference in tumor-derived cells caused an increase in the cell population at G0/G1 phase and reduced the number of cells in the S phase.
20141036 CGGBP-20 downregulates the activity of 5'-region of FMR1 gene in the presence of GCC-triplets only.
19728537 Differences in factors implicated in CGG repeat instability--CGG repeat size, XS548/FRAXAC1 haplotypes, and AGG interspersion pattern-are present in the Basque populations analyzed.
14667814 CGGBP1 was mapped to chromosome 3p and a sequence of 235 nucleotides 5' upstream of CGGBP1 is essential for promoter activity.

AA Sequence

MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR      1 - 70
KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI     71 - 140
PKSDQLRRAYLPDGYENENQLLNSQDC                                               141 - 167
//

Text Mined References (27)

PMID Year Title
26482656 2015 CGGBP1--an indispensable protein with ubiquitous cytoprotective functions.
25981527 2015 CGGBP1 mitigates cytosine methylation at repetitive DNA sequences.
25416956 2014 A proteome-scale map of the human interactome network.
24491049 2014 [Over-expressed microRNA-7 inhibits the growth of human lung cancer cells via suppressing CGGBP1 expression].
24196442 2014 CGGBP1 phosphorylation constitutes a telomere-protection signal.
21733196 2011 CGGBP1 regulates cell cycle in cancer cells.
21269460 2011 Initial characterization of the human central proteome.
20141036 2009 [The role of ZF5 and CGGBP-20 transcription factors in expression regulation of human FMR1 gene responsible for X-fragile syndrome].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19728537 2008 Fragile X gene stability in Basque Valleys: prevalence of premutation and intermediate alleles.
More...