Knowledge Summary

Patent

No data available

Synonym

Accession Q9UFV3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAETYRRSRQHEQLPGQRHMDLLTGYSKLIQSRLKLLLHLGSQPPVGKTFFFSCWCHPLFHGSKTTPNVW      1 - 70
YKFSETALSILNSCQASQLGVRKMPGDMSSSPRVREFSALVAIKEKIHILPTNAKVGSKFGS             71 - 132
//

Text Mined References (1)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.