Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.06
PubTator Score 1.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.61880187982316E-18
juvenile dermatomyositis 1189 2.59368396358573E-9
tuberculosis 1563 4.46132942092653E-6
ulcerative colitis 2087 6.35870762697947E-6
Duchenne muscular dystrophy 602 4.14345079855885E-5
Amyotrophic Lateral Sclerosis 432 7.79575500687506E-4
ovarian cancer 8492 0.0102695182867828
astrocytic glioma 2241 0.0152659090602201
oligodendroglioma 2849 0.043204582751208
aldosterone-producing adenoma 664 0.046512562382245
Disease Target Count Z-score Confidence
Tangier disease 8 3.537 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.900 0.015
oligodendroglioma -2.000 0.043
Duchenne muscular dystrophy 1.637 0.000
juvenile dermatomyositis 1.781 0.000
Amyotrophic Lateral Sclerosis 1.074 0.001
tuberculosis 1.300 0.000
non-small cell lung cancer -1.138 0.000
aldosterone-producing adenoma -1.043 0.047
ulcerative colitis -1.200 0.000
ovarian cancer -1.200 0.010

Synonym

Accession Q9UFN0 A6NM55 Q5VX32 Q9BRV7 Q9H843 Q9P083 NipSnap3A
Symbols TASSC
HSPC299
NIPSNAP4

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Cow OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELV      1 - 70
GYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKP     71 - 140
PKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGR    141 - 210
HKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK                                     211 - 247
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...