Property Summary

NCBI Gene PubMed Count 13
PubMed Score 30.13
PubTator Score 22.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.100 1.5e-05
chronic rhinosinusitis -1.995 3.1e-02
ependymoma 3.000 1.1e-08
lung adenocarcinoma -1.300 1.7e-08
lung carcinoma -1.900 1.4e-06
non-small cell lung carcinoma -1.300 1.4e-10
osteosarcoma -1.181 7.2e-03
pituitary cancer -1.200 7.6e-05

 GO Component (2)

Gene RIF (5)

AA Sequence

MSSEFLAELHWEDGFAIPVANEENKLLEDQLSKLKDERASLQDELREYEERINSMTSHFKNVKQELSITQ      1 - 70
SLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQ     71 - 140
QALEAWLEESAHKDSDALTLQKYAQQDDNKIRALTLQLERLTLECNQKRKILDNELTETISAQLELDKAA    141 - 210
QDFRKIHNERQELIKQWENTIEQMQKRDGDIDNCALELARIKQETREKENLVKEKIKFLESEIGNNTEFE    211 - 280
KRISVADRKLLKCRTAYQDHETSRIQLKGELDSLKATVNRTSSDLEALRKNISKIKKDIHEETARLQKTK    281 - 350
NHNEIIQTKLKEITEKTMSVEEKATNLEDMLKEEEKDVKEVDVQLNLIKGVLFKKAQELQTETMKEKAVL    351 - 420
SEIEGTRSSLKHLNHQLQKLDFETLKQQEIMYSQDFHIQQVERRMSRLKGEINSEEKQALEAKIVELRKS    421 - 490
LEEKKSTCGLLETQIKKLHNDLYFIKKAHSKNSDEKQSLMTKINELNLFIDRSEKELDKAKGFKQDLMIE    491 - 560
DNLLKLEVKRTREMLHSKAEEVLSLEKRKQQLYTAMEERTEEIKVHKTMLASQIRYVDQERENISTEFRE    561 - 630
RLSKIEKLKNRYEILTVVMLPPEGEEEKTQAYYVIKAAQEKEELQREGDCLDAKINKAEKEIYALENTLQ    631 - 700
VLNSCNNNYKQSFKKVTPSSDEYELKIQLEEQKRAVDEKYRYKQRQIRELQEDIQSMENTLDVIEHLANN    701 - 770
VKEKLSEKQAYSFQLSKETEEQKPKLERVTKQCAKLTKEIRLLKDTKDETMEEQDIKLREMKQFHKVIDE    771 - 840
MLVDIIEENTEIRIILQTYFQQSGLELPTASTKGSRQSSRSPSHTSLSARSSRSTSTSTSQSSIKVLELK    841 - 910
FPASSSLVGSPSRPSSASSSSSNVKSKKSSK                                           911 - 941
//

Text Mined References (16)

PMID Year Title