Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
R01 Count 9
Funding $1,179,782.5
PubMed Score 11.95
PubTator Score 6.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 0.021

Gene RIF (8)

PMID Text
25922909 Data show that ORCA acts as a scaffold for the establishment of H3K9 KMT complex.
25170821 Data (from studies using recombinant proteins) suggest that deletion of leucine rich (LRR) domain significantly down-regulates expression of LRWD1 protein; LRR domain is significantly correlated with stability of LRWD1 protein.
23445371 three coding single-nucleotide polymorphisms (SNP1-SNP3) could be detected in Japanese patients with Sertoli cell-only syndrome
23275029 This is the first study showing that the expression of the testis-enriched LRWD1 gene is regulated by NF-kappaB.
22935713 Orc2 protects ORCA from ubiquitin-mediated degradation in vivo.
22645314 propose that the dynamic association of ORCA with pre-RC components modulates the assembly of its interacting partners on chromatin and facilitates DNA replication initiation
22427655 Leucine-rich repeat and WD repeat-containing protein 1 is recruited to pericentric heterochromatin by trimethylated lysine 9 of histone H3 and maintains heterochromatin silencing
20932478 Results suggest ORCA-mediated association of ORC to chromatin is critical to initiate preRC assembly in G1 and chromatin organization in post-G1 cells.

AA Sequence

MGPLSARLLMQRGRPKSDRLGKIRSLDLSGLELLSEHLDPKLLCRLTQLQELDLSNNHLETLPDNLGLSH      1 - 70
LRVLRCANNQLGDVTALCQFPKLEELSLEGNPFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRE     71 - 140
LTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRDVRYGPESLSEFTQWRVRMISEELVAASRTQVQKA    141 - 210
NSPEKPPEAGAAHKPRARLAALKRPDDVPLSLSPSKRACASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQ    211 - 280
CHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL    281 - 350
MVVTQAGHKKRWSVLAAAGLRGLVRLLHVRAGFCCGVIRAHKKAIATLCFSPAHETHLFTASYDKRIILW    351 - 420
DIGVPNQDYEFQASQLLTLDTTSIPLRLCPVASCPDARLLAGCEGGCCCWDVRLDQPQKRRVCEVEFVFS    421 - 490
EGSEASGRRVDGLAFVNEDIVASKGSGLGTICLWSWRQTWGGRGSQSTVAVVVLARLQWSSTELAYFSLS    491 - 560
ACPDKGIVLCGDEEGNVWLYDVSNILKQPPLLPAALQAPTQILKWPQPWALGQVVTKTMVNTVVANASFT    561 - 630
YLTALTDSNIVAIWGRM                                                         631 - 647
//

Text Mined References (30)

PMID Year Title
25922909 2015 The preRC protein ORCA organizes heterochromatin by assembling histone H3 lysine 9 methyltransferases on chromatin.
25170821 2014 Correlation between leucine rich domain and the stability of LRWD1 protein in human NT2/D1 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23445371 2014 Single-nucleotide polymorphisms in the LRWD1 gene may be a genetic risk factor for Japanese patients with Sertoli cell-only syndrome.
23275029 2012 Nuclear factor-?B (NF-?B) regulates the expression of human testis-enriched Leucine-rich repeats and WD repeat domain containing 1 (LRWD1) gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22935713 2012 Orc2 protects ORCA from ubiquitin-mediated degradation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22645314 2012 Dynamic association of ORCA with prereplicative complex components regulates DNA replication initiation.
22427655 2012 Leucine-rich repeat and WD repeat-containing protein 1 is recruited to pericentric heterochromatin by trimethylated lysine 9 of histone H3 and maintains heterochromatin silencing.
More...