Knowledge Summary

Patent

No data available

Synonym

Accession Q9UF83 Q9NTQ6 Q9UFS5
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MRRPSTASLTRTPSRASPTRMPSRASLKMTPFRASLTKMESTALLRTLPRASLMRTPTRASLMRTPPRAS      1 - 70
PTRKPPRASPRTPSRASPTRRLPRASPMGSPHRASPMRTPPRASPTGTPSTASPTGTPSSASPTGTPPRA     71 - 140
SPTGTPPRAWATRSPSTASLTRTPSRASLTRWPPRASPTRTPPRESPRMSHRASPTRTPPRASPTRRPPR    141 - 210
ASPTRTPPRESLRTSHRASPTRMPPRASPTRRPPRASPTGSPPRASPMTPPRASPRTPPRASPTTTPSRA    211 - 280
SLTRTPSWASPTTTPSRASLMKMESTVSITRTPPRASPTGTPSRASPTGTPSRASLTGSPSRASLTGTPS    281 - 350
RASLIGTPSRASLIGTPSRASLTGTPPRASLTGTSSTASLTRTPSRASLTRTQSSSSLTRTPSMASLTRT    351 - 420
PPRASLTRTPPRASLTRTPPRASLTRTPPRASLTRTPSMVSLKRSPSRASLTRTPSRASLTMTPSRASLT    421 - 490
RTPSTASLTGTPPTASLTRTPPTASLTRSPPTASLTRTPSTASLTRMPSTASLTRKSNVNQQCPASTPSS    491 - 560
EVIS                                                                      561 - 564
//

Text Mined References (1)

PMID Year Title