Knowledge Summary

Patent

No data available

AA Sequence

MRRPSTASLTRTPSRASPTRMPSRASLKMTPFRASLTKMESTALLRTLPRASLMRTPTRASLMRTPPRAS      1 - 70
PTRKPPRASPRTPSRASPTRRLPRASPMGSPHRASPMRTPPRASPTGTPSTASPTGTPSSASPTGTPPRA     71 - 140
SPTGTPPRAWATRSPSTASLTRTPSRASLTRWPPRASPTRTPPRESPRMSHRASPTRTPPRASPTRRPPR    141 - 210
ASPTRTPPRESLRTSHRASPTRMPPRASPTRRPPRASPTGSPPRASPMTPPRASPRTPPRASPTTTPSRA    211 - 280
SLTRTPSWASPTTTPSRASLMKMESTVSITRTPPRASPTGTPSRASPTGTPSRASLTGSPSRASLTGTPS    281 - 350
RASLIGTPSRASLIGTPSRASLTGTPPRASLTGTSSTASLTRTPSRASLTRTQSSSSLTRTPSMASLTRT    351 - 420
PPRASLTRTPPRASLTRTPPRASLTRTPPRASLTRTPSMVSLKRSPSRASLTRTPSRASLTMTPSRASLT    421 - 490
RTPSTASLTGTPPTASLTRTPPTASLTRSPPTASLTRTPSTASLTRMPSTASLTRKSNVNQQCPASTPSS    491 - 560
EVIS                                                                      561 - 564
//

Text Mined References (1)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.