Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
oligodendroglioma 2850 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.8e-09
malignant mesothelioma 3232 8.3e-06
osteosarcoma 7950 9.1e-06
psoriasis 6694 1.0e-04
group 3 medulloblastoma 4104 2.9e-04
colon cancer 1478 9.1e-03
astrocytic glioma 2597 1.3e-02
active Crohn's disease 922 1.7e-02
Disease Target Count Z-score Confidence
Brain glioma 7 3.936 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.164 1.7e-02
astrocytic glioma -1.300 1.3e-02
colon cancer -1.300 9.1e-03
group 3 medulloblastoma 1.700 2.9e-04
malignant mesothelioma 2.000 8.3e-06
osteosarcoma -1.089 9.1e-06
ovarian cancer -1.600 1.8e-09
psoriasis -2.000 1.0e-04

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (5)

AA Sequence

MCLLSSSAASDLAATSLTAHPCHPPLPRQPQPQLILSGSPSIGTVPPPAVGHTSLLPVNPPAISTTTSDL      1 - 70
SAREDATPSASTGHLSVFPAFQVKIPAVPSEQTSQSFSEASHRVLPGGGPRCSRDFGAGVAGHLGLGIFG     71 - 140
VGFGSPALLQSVVDENSCCLLYVVEDQLCDVEQAFRAEHLGQHQSGSGTGCRHCPQRPAAL             141 - 201
//

Text Mined References (11)

PMID Year Title