Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UF72
Symbols PDAM
KIAA0495

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
26410378 KIAA0495 methylation was detected in none of both primary myeloma samples at diagnosis (N = 61) and at relapse/progression (N = 16). KIAA0495 methylation appeared unimportant in the pathogenesis or progression of myeloma.
22388545 Report expression of TP73 isoforms in human cell lines.
20477830 The study suggested that PDAM might function as a non-protein-coding RNA.And PDAM deregulation play a role in oligodendroglial tumors development, PDAM may possess the capacity to modulate apoptosis via regulation of p53-dependent anti-apoptotic genes.
20477830 PDAM knockdown induces cisplatin resistance in glioma cells harboring wild-type p53. The finding suggests that PDAM may possess the capacity to modulate apoptosis via regulation of p53-dependent anti-apoptotic genes (BCL2 and BCL2L1).

AA Sequence

MCLLSSSAASDLAATSLTAHPCHPPLPRQPQPQLILSGSPSIGTVPPPAVGHTSLLPVNPPAISTTTSDL      1 - 70
SAREDATPSASTGHLSVFPAFQVKIPAVPSEQTSQSFSEASHRVLPGGGPRCSRDFGAGVAGHLGLGIFG     71 - 140
VGFGSPALLQSVVDENSCCLLYVVEDQLCDVEQAFRAEHLGQHQSGSGTGCRHCPQRPAAL             141 - 201
//

Text Mined References (8)

PMID Year Title
26410378 2015 Epigenetic silencing of a long non-coding RNA KIAA0495 in multiple myeloma.
23726844 2013 A long non-coding RNA signature in glioblastoma multiforme predicts survival.
22388545 2012 Relative expression of TAp73 and ?Np73 isoforms.
20477830 2010 KIAA0495/PDAM is frequently downregulated in oligodendroglial tumors and its knockdown by siRNA induces cisplatin resistance in glioma cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.