Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.17
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9UF56 A1A4E3
Symbols Fbl17
Fbx13
FBXO13

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (5)

AA Sequence

MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRTPAKVPPQPAAPRSRDCFFRGPCMLCFIVHSPGA      1 - 70
PAPAGPEEEPPLSPPPRDGAYAAASSSQHLARRYAALAAEDCAAAARRFLLSSAAAAAAAAASASSPASC     71 - 140
CKELGLAAAAAWEQQGRSLFLASLGPVRFLGPPAAVQLFRGPTPSPAELPTPPEMVCKRKGAGVPACTPC    141 - 210
KQPRCGGGGCGGGGGGGGGGGPAGGGASPPRPPDAGCCQAPEQPPQPLCPPPSSPTSEGAPTEAGGDAVR    211 - 280
AGGTAPLSAQQQHECGDADCRESPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCK    281 - 350
YWRDLCLDFQFWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAY    351 - 420
RCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCL    421 - 490
KLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVME    491 - 560
IVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEI    561 - 630
TDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAAS    631 - 700
S//

Text Mined References (16)

PMID Year Title