Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.33
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 6.4e-07
medulloblastoma, large-cell 6241 7.2e-05
atypical teratoid / rhabdoid tumor 5112 8.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 8.5e-04
lung carcinoma -1.200 6.4e-07
medulloblastoma, large-cell 1.500 7.2e-05

Gene RIF (2)

AA Sequence

MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAI      1 - 70
LTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHC     71 - 140
RPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS               141 - 199
//

Text Mined References (12)

PMID Year Title