Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.85
PubTator Score 4.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.026
nephrosclerosis -1.817 0.003
osteosarcoma 1.499 0.000

Synonym

Accession Q9UF12
Symbols HYPDH
HSPOX1

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (4)

PMID Text
25697095 Data suggest that residues 157-515 of PRODH2 contain catalytic core with one FAD molecule; PRODH2 most likely utilizes coenzyme Q10 as terminal electron acceptor in vivo; PRODH2 exhibits substrate specificity for hydroxyproline over proline.
23861960 PRODH, but not PRODH2, expression is under the control of p53 family members, specifically p53 and p73.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18287100 OH-POX plays a role analogous to POX in growth regulation, ROS generation, and activation of the apoptotic cascade

AA Sequence

MSPRVVSNSSVLASQSVGITNVRTVFSNVFNNTTAFPILRGSNCHKITAPGLGKGQLVNLLPPENLPWCG      1 - 70
GSQGPRMLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVLRLCAWPPLVTHGLLLQAWSR     71 - 140
RLLGSRLSGAFLRASVYGQFVAGETAEEVKGCVQQLRTLSLRPLLAVPTEEEPDSAAKSGEAWYEGNLGA    141 - 210
MLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVS    211 - 280
CLNAEQNQHLRASLSRLHRVAQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQ    281 - 350
ACLKDTFERLGRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLT    351 - 420
HVARHGPMCHLMVASHNEESVRQATKRMWELGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGS    421 - 490
LEEVIPYLIRRAQENRSVLQGARREQELLSQELWRRLLPGCRRIPH                            491 - 536
//

Text Mined References (5)

PMID Year Title
25697095 2015 Proline dehydrogenase 2 (PRODH2) is a hydroxyproline dehydrogenase (HYPDH) and molecular target for treating primary hyperoxaluria.
23861960 2013 P53 family members modulate the expression of PRODH, but not PRODH2, via intronic p53 response elements.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18287100 2008 A novel function for hydroxyproline oxidase in apoptosis through generation of reactive oxygen species.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.