Property Summary

NCBI Gene PubMed Count 15
PubMed Score 75.57
PubTator Score 37.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 1.010 1.9e-02
atypical teratoid / rhabdoid tumor -2.100 3.2e-06
Breast cancer -1.300 9.1e-04
Down syndrome 1.200 4.0e-03
facioscapulohumeral dystrophy 1.600 6.0e-03
group 3 medulloblastoma -3.500 1.2e-05
lung cancer 3.400 3.4e-05
lung carcinoma 2.100 2.4e-19
medulloblastoma, large-cell -3.100 6.1e-06
non-small cell lung cancer -1.236 9.6e-07
oligodendroglioma 1.400 2.8e-02
pediatric high grade glioma -1.200 5.3e-03
pituitary cancer -2.000 4.7e-04
psoriasis -1.200 2.1e-27

Gene RIF (6)

AA Sequence

MSPAAPVPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHF      1 - 70
NVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPAPAGATVPPR     71 - 140
SRRVCSKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVRED    141 - 210
PCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF                                         211 - 243
//

Text Mined References (15)

PMID Year Title