Property Summary

NCBI Gene PubMed Count 15
Grant Count 17
R01 Count 15
Funding $2,605,122.5
PubMed Score 72.79
PubTator Score 37.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
oligodendroglioma 1.400 0.028
sonic hedgehog group medulloblastoma -4.400 0.000
atypical teratoid/rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.100 0.000
non-small cell lung cancer -1.236 0.000
lung cancer 3.400 0.000
active ulcerative colitis 1.010 0.019
pediatric high grade glioma -1.200 0.005
lung carcinoma 2.100 0.000
Breast cancer -1.300 0.001
pituitary cancer -2.000 0.000
Down syndrome 1.200 0.004
psoriasis -1.200 0.000
facioscapulohumeral dystrophy 1.600 0.006

Gene RIF (6)

PMID Text
26318175 The human PHR1, a PH domain-containing protein with low expression in the heart and high expression in the brain, interacts with coxsackievirus B3 VP1, a major structural protein of coxsackievirus B3.
24840802 Rapid Wallerian degeneration requires the pro-degenerative molecules PHR1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20308990 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20301200 Phr1 is widely and abundantly expressed throughout mature olfactory neurons and other primary sensory neurons, but its absence does not appear to affect olfactory morphology, regeneration, sensory function, or adaptation.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSPAAPVPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHF      1 - 70
NVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPAPAGATVPPR     71 - 140
SRRVCSKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVRED    141 - 210
PCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF                                         211 - 243
//

Text Mined References (15)

PMID Year Title
26318175 2015 In vitro interaction between coxsackievirus B3 VP1 protein and human pleckstrin homology domain retinal protein (PHR1).
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
24840802 2014 Wallerian degeneration: an emerging axon death pathway linking injury and disease.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20308990 2011 Genome-wide copy number variation analysis in attention-deficit/hyperactivity disorder: association with neuropeptide Y gene dosage in an extended pedigree.
20301200 2010 PHR1 is a vesicle-bound protein abundantly expressed in mature olfactory neurons.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
More...