Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.44
PubTator Score 0.90

Knowledge Summary

Patent (179)

TINX Plot

  Disease (4)

Disease Target Count
Bipolar Disorder 666
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cognitive disorder 50 0.0 1.9
Disease Target Count Z-score Confidence
Spinal cord ependymoma 2 5.562 2.8

Gene RIF (2)

AA Sequence

MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERG      1 - 70
RCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFIL     71 - 140
SGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMY    141 - 210
RPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC         211 - 275
//

Text Mined References (10)

PMID Year Title