Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 0.90

Knowledge Summary

Patent (179)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cognitive disorder 44 1.0

Synonym

Accession Q9UF02 A8K2A6 Q547R3 Q8WXS7 Q9UHM3
Symbols

Gene

  TechDev Info (1)

Susumu Tomita Channel activity

Gene RIF (1)

PMID Text
21057379 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERG      1 - 70
RCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFIL     71 - 140
SGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMY    141 - 210
RPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC         211 - 275
//

Text Mined References (9)

PMID Year Title
21057379 2011 Case-case genome-wide association analysis shows markers differentially associated with schizophrenia and bipolar disorder and implicates calcium channel genes.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927536 2002 The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.
10613843 1999 Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication.