Property Summary

NCBI Gene PubMed Count 32
PubMed Score 80.98
PubTator Score 20.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Biliary atresia 12 4.102 2.1
Alzheimer's disease 658 3.501 1.8
Dyscalculia 5 3.276 1.6
Disease Target Count
Spastic Quadriplegia 42

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.093 1.9e-03
aldosterone-producing adenoma -1.183 3.1e-02
Amyotrophic lateral sclerosis 1.001 9.7e-05
Atopic dermatitis -1.100 5.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.476 1.1e-02
Breast cancer -2.000 2.8e-06
breast carcinoma -1.400 5.8e-31
Crohn's disease -1.091 8.0e-03
dermatomyositis 1.200 7.7e-03
Down syndrome 1.200 9.7e-04
Duchenne muscular dystrophy 1.674 1.5e-06
fascioscapulohumeral muscular dystrophy 1.003 2.3e-03
glioblastoma -1.100 7.3e-04
group 3 medulloblastoma -1.500 1.7e-04
intraductal papillary-mucinous adenoma (... 1.100 4.8e-03
invasive ductal carcinoma -1.600 1.9e-03
juvenile dermatomyositis 1.491 5.9e-10
lung adenocarcinoma -1.200 1.6e-06
lung cancer 1.200 9.4e-04
medulloblastoma, large-cell -2.400 4.6e-06
osteosarcoma 1.770 3.3e-04
ovarian cancer -1.900 1.7e-08
pancreatic cancer 1.100 3.0e-02
Pick disease 1.100 2.8e-04
primary pancreatic ductal adenocarcinoma 1.207 2.7e-02
psoriasis 1.400 2.5e-03
Rheumatoid arthritis 1.300 4.7e-03
spina bifida -1.580 4.0e-02
ulcerative colitis -1.146 2.7e-02
Waldenstrons macroglobulinemia 1.391 7.3e-03

 GO Process (1)

Gene RIF (23)

AA Sequence

MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFRED      1 - 70
LECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTSSYVKGEKLTRCK     71 - 140
LASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDH    141 - 210
TGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLGDVAYYDYQGSLEEQEERIQLQK    211 - 280
VLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAA    281 - 350
SGGGGVNMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLIREKPRHKSDVEIPATVTAFSFEDDTV    351 - 420
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSGGTPIKIEDPNQ    421 - 490
FVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG    491 - 560
ELEEYKRTIERKQQGLEDAEQELLSDDASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVN    561 - 630
GKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPEGSPSKSPSKKKKKFRTPSFLKKNKK    631 - 700
KEKVEA                                                                    701 - 706
//

Text Mined References (44)

PMID Year Title