Property Summary

NCBI Gene PubMed Count 62
Grant Count 71
R01 Count 57
Funding $6,282,752.36
PubMed Score 131.28
PubTator Score 88.03

Knowledge Summary

Patent (12,571)

Expression

Synonym

Accession Q9UEW8 O14774 Q53S90 Q53SL7 Q53SS1 Q9UER4 X5D9C8 Ste-20-related kinase
Symbols DCHT
PASK
SPAK

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (55)

PMID Text
27082544 Single nucleotide polymorphisms STK39 and WNK1 were associated with hypertension and BP in our multicenter Belgian case-control study
26673921 SPAK and OSR1 are both stimulators of Kir2.1 activity.
26662444 STK39 mRNA and protein express abnormally in primary hypertension patients with genetic variation, which is related to the blood pressure.
26584301 SPAK protein has both the potential to up-regulate KCNQ1/E1 protein abundance in the cell membrane, an effect possibly participating in the regulation of cell volume, excitability, epithelial transport and metabolism.
26506223 SPAK and OSR1 are powerful stimulators of the intestinal Na+-coupled phosphate co-transporter NaPi-IIb
26469904 These findings suggested that the STK39 rs1955337 TT genotype is a risk factor for Han-Chinese patients with PD in Taiwan
26416847 Findings indicate that the serine threonine kinase 39 (STK39) mRNA expression is increased in rs3754777 knockin cell lines.
26233565 SPAK and OSR1 are powerful negative regulators of the excitatory glutamate transporters EAAT1 and EAAT2.
26112741 SPAK and OSR1 are negative regulators of EAAT3 activity
25994507 These observations establish that the CCT domain plays a crucial role in controlling SPAK activity and BP.
More...

AA Sequence

MAEPSGSPVHVQLPQQAAPVTAAAAAAPAAATAAPAPAAPAAPAPAPAPAAQAVGWPICRDAYELQEVIG      1 - 70
SGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPNVVTYYTSFVVKDELWLVMKL     71 - 140
LSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGEDGSVQIAD    141 - 210
FGVSAFLATGGDVTRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMK    211 - 280
VLMLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKL    281 - 350
LTRTPDIAQRAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSAS    351 - 420
TIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAG    421 - 490
LVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQLSVS                   491 - 545
//

Text Mined References (73)

PMID Year Title
27082544 2016 STK39 and WNK1 Are Potential Hypertension Susceptibility Genes in the BELHYPGEN Cohort.
26673921 2015 SPAK and OSR1 Sensitive Kir2.1 K+ Channels.
26662444 2015 Expression of STK39 in peripheral blood of hypertension patients and the relationship between its genetic polymorphism and blood pressure.
26584301 2015 SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels.
26506223 2015 Up-Regulation of Intestinal Phosphate Transporter NaPi-IIb (SLC34A2) by the Kinases SPAK and OSR1.
26469904 2015 STK39, But Not BST1, HLA-DQB1, and SPPL2B Polymorphism, Is Associated With Han-Chinese Parkinson's Disease in Taiwan.
26416847 2015 Generation of Hypertension-Associated STK39 Polymorphism Knockin Cell Lines With the Clustered Regularly Interspaced Short Palindromic Repeats/Cas9 System.
26233565 2015 Down-Regulation of Excitatory Amino Acid Transporters EAAT1 and EAAT2 by the Kinases SPAK and OSR1.
26112741 2015 SPAK and OSR1 Sensitivity of Excitatory Amino Acid Transporter EAAT3.
25994507 2015 Critical role of the SPAK protein kinase CCT domain in controlling blood pressure.
More...