Property Summary

NCBI Gene PubMed Count 30
Grant Count 14
R01 Count 5
Funding $1,012,543
PubMed Score 151.95
PubTator Score 162.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis 1.700 0.000
adrenocortical carcinoma -1.260 0.000
tuberculosis 1.500 0.000
pancreatic ductal adenocarcinoma liver m... -1.998 0.001
non-small cell lung cancer -3.380 0.000
lung cancer -3.500 0.000
colon cancer -1.100 0.000
pancreatic cancer 1.100 0.004
breast carcinoma -1.200 0.040
fibroadenoma -2.100 0.043
lung adenocarcinoma -3.200 0.000
aldosterone-producing adenoma -1.216 0.034
lung carcinoma -1.800 0.000
ductal carcinoma in situ -1.900 0.009
invasive ductal carcinoma -2.300 0.015
ovarian cancer -4.600 0.000

Gene RIF (22)

PMID Text
26892079 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26886650 identified as a disease-associated molecule in IgG4-related disease by DNA microarray
25186548 None of the nonsynonymous variants discovered by resequencing of the structurally similar MARCO were associated with lung function or risk of COPD.
25089661 Vaccinia virus bound directly to MARCO, and overexpression of MARCO increased susceptibility to vaccinia infection.
23739639 herpes simplex virus type 1 binds to MARCO to enhance its capacity for disease.
23617307 Polymorphisms within the human class A scavenger receptor MARCO correlate with susceptibility/resistance to tuberculosis in a Gambian population.
23249958 Significant associations of four SNPs and haplotypes with antibody response to cholera vaccine in three genes, MARCO, TNFAIP3 and CXCL12.
23154236 We identified 9 non-synonymous variants in the MARCO gene and showed that these variants are not major risk factors for COPD or lung infection. H101Q heterozygotes had increased sepsis risk.
22470186 This review demonstrated that class A SR and MARCO are major pattern recognition receptors mediating opsonin-independent phagocytosis.
22470185 In this review, we showed that SR-A and MARCO trigger intracellular signaling, modulating pro-inflammatory and microbicidal activities of macrophages.
More...

AA Sequence

MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGAGLLVVQVLNL      1 - 70
QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRVSHEHLLQRVDNFTQN     71 - 140
PGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAKGAMGRDGATGPSGPQGPPGVKGEAGLQGPQ    141 - 210
GAPGKQGATGTPGPQGEKGSKGDGGLIGPKGETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKG    211 - 280
DFGRPGPPGLAGFPGAKGDQGQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGS    281 - 350
KGDTGLQGQQGRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN    351 - 420
SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRG    421 - 490
TESTLWSCTKNSWGHHDCSHEEDAGVECSV                                            491 - 520
//

Text Mined References (34)

PMID Year Title
26892079 2016 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26886650 2016 DNA Microarray Analysis of Submandibular Glands in IgG4-Related Disease Indicates a Role for MARCO and Other Innate Immune-Related Proteins.
25186548 2014 Genetic variations in scavenger and ??-adrenergic receptors and risk of pulmonary disease.
25089661 2015 Vaccinia virus binds to the scavenger receptor MARCO on the surface of keratinocytes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23739639 2013 HSV-1 exploits the innate immune scavenger receptor MARCO to enhance epithelial adsorption and infection.
23617307 2013 Genetic variants of MARCO are associated with susceptibility to pulmonary tuberculosis in a Gambian population.
23249958 2013 Genomic correlates of variability in immune response to an oral cholera vaccine.
23154236 2013 Genetic variation in the scavenger receptor MARCO and its association with chronic obstructive pulmonary disease and lung infection in 10,604 individuals.
22470186 2012 [The role of the class A scavenger receptors, SR-A and MARCO, in the immune system. Part 2. Contribution to recognition and phagocytosis of pathogens as well as induction of immune response].
More...