Property Summary

NCBI Gene PubMed Count 22
PubMed Score 45.92
PubTator Score 17.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.600 3.6e-04
medulloblastoma, large-cell 1.100 1.1e-05
ovarian cancer 1.900 1.0e-05
Pick disease -1.100 4.1e-04
spina bifida -1.152 4.0e-02

Gene RIF (10)

AA Sequence

MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGH      1 - 70
VVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAAL     71 - 140
NIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLS    141 - 210
KPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTL    211 - 280
KRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP                         281 - 329
//

Text Mined References (27)

PMID Year Title