Property Summary

NCBI Gene PubMed Count 204
PubMed Score 233.00
PubTator Score 238.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Pancreatic Neoplasm 85
Disease Target Count P-value
lung cancer 4740 4.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.2
Disease Target Count Z-score Confidence
Thalassemia 53 4.623 2.3
Intellectual disability 1016 4.16 2.1
Cancer 2499 3.979 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.400 4.3e-04

Gene RIF (141)

AA Sequence

MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEF      1 - 70
LELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAK     71 - 140
KKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKEL    141 - 210
DLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGP    211 - 280
DTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP    281 - 350
ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS    351 - 420
GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGK    421 - 490
DGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEE    491 - 560
SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCK    561 - 630
KSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI    631 - 700
PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD                                  701 - 740
//

Text Mined References (221)

PMID Year Title