Property Summary

NCBI Gene PubMed Count 192
Grant Count 113
R01 Count 88
Funding $12,675,722.54
PubMed Score 222.33
PubTator Score 238.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.400 0.000

Synonym

Accession Q9UER7 B4E1I3 F5ANJ6 F5ANJ7 F5H082 O14747 O15141 O15208 Q5STK9 Q9BWI3
Symbols DAP6
EAP1
BING2

Gene

PDB

2KQS   4H9N   4H9O   4H9P   4H9Q   4H9R   4H9S   4HGA   5KDM   2KZU   2KZS  

Gene RIF (133)

PMID Text
26812044 HDAC1 and DAXX are co-repressors associated with epigenetic regulation that help to control promoter histone acetylation reactions involved in regulating GAD67.
26773061 We provide an overview of the individual components (ATRX, DAXX and/or H3.3) tested in each study and propose a model where the ATRX/DAXX chaperone complex deposits H3.3 to maintain the H3K9me3 modification at heterochromatin throughout the genome.
26566030 identifying Daxx as a broad cellular inhibitor of reverse-transcription. Altogether, these findings unravel a novel antiviral function for PML and PML nuclear body-associated protein Daxx
26468536 Studies of the dynamics of the response of PML nuclear body components and IFI16 to invading herpes simplex virus 1 genomes demonstrated that human Daxx (hDaxx) and IFI16 respond more rapidly than PML.
26340527 Daxx and Atrx safeguard the genome by silencing repetitive elements when DNA methylation levels are low.
26148509 Knock-down of the cellular DAXX protein modulates the human papillomavirus genome replication and transcription in U2OS cells--papillomavirus replication is reduced in the absence of this component of ND10.
26057166 PML, hDaxx and Sp100 primarily act as cellular restriction factors during lytic human cytomegalovirus replication and during the dynamic process of reactivation but do not serve as key determinants for the establishment of latency.
25903140 establish DAXX as a pro-survival protein in PCa and reveal that, in the early stages of tumorigenesis, autophagy suppresses prostate tumor formation.
25900181 ATRX- and DAXX-deficient PNETs have distinct genome-wide DNA methylation profiles. Loss of DAXX and not ATRX appears to be the driver event in altering genome-wide methylation changes in PNETs.
25842852 Daxx protein interacts with HPV16 E2 protein, mainly in cytoplasm.
More...

AA Sequence

MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEF      1 - 70
LELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAK     71 - 140
KKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKEL    141 - 210
DLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGP    211 - 280
DTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP    281 - 350
ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS    351 - 420
GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGK    421 - 490
DGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEE    491 - 560
SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCK    561 - 630
KSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI    631 - 700
PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD                                  701 - 740
//

Text Mined References (208)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27029610 2016 ATRX binds to atypical chromatin domains at the 3' exons of zinc finger genes to preserve H3K9me3 enrichment.
26812044 2016 Toward dissecting the etiology of schizophrenia: HDAC1 and DAXX regulate GAD67 expression in an in vitro hippocampal GABA neuron model.
26773061 2016 New players in heterochromatin silencing: histone variant H3.3 and the ATRX/DAXX chaperone.
26566030 2015 PML/TRIM19-Dependent Inhibition of Retroviral Reverse-Transcription by Daxx.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26468536 2015 Dynamic Response of IFI16 and Promyelocytic Leukemia Nuclear Body Components to Herpes Simplex Virus 1 Infection.
26340527 2015 The Daxx/Atrx Complex Protects Tandem Repetitive Elements during DNA Hypomethylation by Promoting H3K9 Trimethylation.
26148509 2015 DAXX modulates human papillomavirus early gene expression and genome replication in U2OS cells.
26057166 2015 Contribution of the Major ND10 Proteins PML, hDaxx and Sp100 to the Regulation of Human Cytomegalovirus Latency and Lytic Replication in the Monocytic Cell Line THP-1.
More...