Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
Funding $77,500
PubMed Score 51.82
PubTator Score 26.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession Q9UEE9 O00393 O00404 Q9UEF0 Q9UEF1 Q9UEF8
Symbols p97
BCNT
CP27
SWC5
Yeti
CENP-29
BUCENTAUR

Gene

 Grant Application (2)

Gene RIF (4)

PMID Text
26182435 Bcnt/Cfdp1 is acetylated in vitro by CREB-binding protein (CBP) and four lysine residues including Lys(268) in BCNT-C are also acetylated in vivo, revealing a protein regulated at multiple levels.
23152477 This study identified rs4888378 in the BCAR1-CFDP1-TMEM170A locus as a novel genetic determinant of carotid intima-media thickness and coronary artery disease risk.
19844255 Observational study of gene-disease association. (HuGE Navigator)
11831036 includes the region derived from a long interspersed nucleotide

AA Sequence

MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSL      1 - 70
EEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETE     71 - 140
ETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALP    141 - 210
SLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDR    211 - 280
VDHRQFEIERDLRLSKMKP                                                       281 - 299
//

Text Mined References (23)

PMID Year Title
26182435 2015 Mammalian Bcnt/Cfdp1, a potential epigenetic factor characterized by an acidic stretch in the disordered N-terminal and Ser250 phosphorylation in the conserved C-terminal regions.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152477 2012 Identification of the BCAR1-CFDP1-TMEM170A locus as a determinant of carotid intima-media thickness and coronary artery disease risk.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21269460 2011 Initial characterization of the human central proteome.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...