Property Summary

NCBI Gene PubMed Count 17
PubMed Score 57.22
PubTator Score 26.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.125 1.7e-02
cystic fibrosis and chronic rhinosinusit... -1.019 5.0e-03
dermatomyositis 1.400 8.5e-04
ependymoma 1.300 5.1e-03
interstitial lung disease 1.100 4.9e-03
intraductal papillary-mucinous adenoma (... 1.400 3.3e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.3e-02
malignant mesothelioma 1.700 4.8e-05
oligodendroglioma 1.300 3.5e-03
osteosarcoma 2.257 1.3e-05
ovarian cancer -1.600 4.3e-07
Pick disease 1.200 3.3e-05
Pneumonia -1.100 1.4e-03
tuberculosis 1.300 8.7e-07
ulcerative colitis -1.300 3.2e-06
Waldenstrons macroglobulinemia 1.262 6.1e-03

Gene RIF (4)

AA Sequence

MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSL      1 - 70
EEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETE     71 - 140
ETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALP    141 - 210
SLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDR    211 - 280
VDHRQFEIERDLRLSKMKP                                                       281 - 299
//

Text Mined References (24)

PMID Year Title