Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $129,195
PubMed Score 10.47
PubTator Score 10.40

Knowledge Summary

Patent (2,327)

Expression

  Differential Expression (23)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.001
Waldenstrons macroglobulinemia -1.328 0.043
Chronic Lymphocytic Leukemia -1.017 0.042
Multiple myeloma 1.516 0.030
malignant mesothelioma -1.500 0.000
cutaneous lupus erythematosus 1.700 0.003
psoriasis 2.100 0.001
astrocytoma 1.100 0.000
glioblastoma 3.400 0.000
oligodendroglioma 1.300 0.000
osteosarcoma -2.711 0.000
tuberculosis and treatment for 3 months -2.000 0.000
lung cancer -2.400 0.006
diabetes mellitus -1.200 0.025
interstitial cystitis 1.800 0.001
pediatric high grade glioma 2.300 0.000
group 3 medulloblastoma 1.700 0.012
pilocytic astrocytoma 1.800 0.000
primary Sjogren syndrome 2.400 0.000
aldosterone-producing adenoma -1.800 0.006
lung carcinoma -2.000 0.000
Breast cancer -1.300 0.000
ovarian cancer 2.100 0.000

Synonym

Accession Q9UEE5 A4D1V6 Q8IVC8
Symbols DRAK1

Gene

 Grant Application (2)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (8)

PMID Text
26305096 the present study was the first to find localization of STK17A in normal bile canaliculi.
25531329 DRAK1 was predominantly localized in the cytoplasm and bound to Smad3, thereby interrupting Smad3/Smad4 complex formation, which is the core process for the induction of tumor suppressor genes by TGF-beta1
24312360 STK17A provides a proliferative and survival advantage to GBM cells
24162774 HIV-1 gp120 upregulates the expression of serine/threonine kinase 17a (STK17A) in human B cells
23860322 When analyzing STK17A haplotypes distribution, we found association between TGGTC, TAGTC and AAGAT haplotypes and risk to develop SLE
21489989 identified STK17A as a novel direct target of p53 and a modulator of cisplatin toxicity and reactive oxygen species in testicular cancer cells.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRG      1 - 70
KFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEY     71 - 140
AAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGL    141 - 210
SRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNL    211 - 280
SYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVP    281 - 350
EINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFIY          351 - 414
//

Text Mined References (20)

PMID Year Title
26305096 2015 Abnormal Localization of STK17A in Bile Canaliculi in Liver Allografts: An Early Sign of Chronic Rejection.
25531329 2015 Cytoplasmic DRAK1 overexpressed in head and neck cancers inhibits TGF-?1 tumor suppressor activity by binding to Smad3 to interrupt its complex formation with Smad4.
24312360 2013 Serine/threonine kinase 17A is a novel candidate for therapeutic targeting in glioblastoma.
23860322 2013 Polymorphisms in STK17A gene are associated with systemic lupus erythematosus and its clinical manifestations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21802008 2011 High-throughput kinase profiling: a more efficient approach toward the discovery of new kinase inhibitors.
21489989 2011 Serine/threonine kinase 17A is a novel p53 target gene and modulator of cisplatin toxicity and reactive oxygen species in testicular cancer cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...