Property Summary

NCBI Gene PubMed Count 120
Grant Count 140
R01 Count 82
Funding $19,838,249.49
PubMed Score 241.61
PubTator Score 234.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 1.100 0.000
osteosarcoma -1.538 0.000
ependymoma 1.100 0.000
glioblastoma 1.600 0.001
medulloblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
primitive neuroectodermal tumor 1.200 0.002
lung cancer 4.300 0.000
pediatric high grade glioma 1.300 0.000
subependymal giant cell astrocytoma 2.173 0.033
gastric carcinoma 1.100 0.028
ovarian cancer 1.200 0.000
Gaucher disease type 3 -1.200 0.011

Synonym

Accession Q9UDY8 Q9NTB7 Q9ULX4
Symbols MLT
MLT1
IMD12
PCASP1

Gene

PDB

2G7R   3BFO   3K0W   3UO8   3UOA   3V4O   3V55   4I1P   4I1R  

Gene RIF (89)

PMID Text
27068814 TCR-induced alternative splicing augments MALT1 scaffolding to enhance downstream signalling and to promote optimal T-cell activation.
26788853 Backbone Assignment of the MALT1 Paracaspase by Solution NMR.
26787500 Targeting MALT1 proteolytic activity in autoimmune disease and B-cell lymphoma might not be a successful strategy. (Review)
26767426 MALT1 protease activity has a central role in keratinocyte immunity
26716947 The MALT1 is a key player in the activation of the NF-kappa B upon antigen receptor stimulation and lymphocyte activation.
26668357 Data show that caspase recruitment domain-containing protein 11/B-cell CLL/lymphoma 10/mucosa-associated lymphoid tissue lymphoma translocation gene 1 signaling drives lymphoproliferation through NF-kappa B and c-Jun N-terminal kinase activation.
26573773 The MALT1-mediated HOIL-1 cleavage provides a gain-of-function mechanism that is involved in the negative feedback regulation of NF-kappaB signaling.
26540570 Data show that Bruton tyrosine kinase (BTK)inhibitor Ibrutinib augments MALT lymphoma associated translocation protein (MALT1) inhibition by S-Mepazine in CD79 antigen mutant activated B cell-subtype (ABC) of diffuse large B cell lymphoma (DLBCL).
26525107 By regulating linear ubiquitination, MALT1 is both a positive and negative pleiotropic regulator of the human canonical NF-kappaB pathway.
26507244 An overview of the present understanding of MALT1's function is presented. [review]
More...

AA Sequence

MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLS      1 - 70
CLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLA     71 - 140
GQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCD    141 - 210
IPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYV    211 - 280
DLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGN    281 - 350
MNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF    351 - 420
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGY    421 - 490
ATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRAL    491 - 560
TDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDA    561 - 630
YVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVE    631 - 700
DKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSN    701 - 770
VTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK                    771 - 824
//

Text Mined References (126)

PMID Year Title
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
27068814 2016 Alternative splicing of MALT1 controls signalling and activation of CD4(+) T cells.
26788853 2016 Backbone Assignment of the MALT1 Paracaspase by Solution NMR.
26787500 2016 Targeting MALT1 Proteolytic Activity in Immunity, Inflammation and Disease: Good or Bad?
26767426 2016 MALT1 Protease Activity Controls the Expression of Inflammatory Genes in Keratinocytes upon Zymosan Stimulation.
26716947 2016 The paracaspase MALT1 dampens NF-?B signalling by cleaving the LUBAC subunit HOIL-1.
26668357 2015 Lymphomagenic CARD11/BCL10/MALT1 signaling drives malignant B-cell proliferation via cooperative NF-?B and JNK activation.
26573773 2016 MALT1 cleaves the E3 ubiquitin ligase HOIL-1 in activated T cells, generating a dominant negative inhibitor of LUBAC-induced NF-?B signaling.
26540570 2015 Combinatorial BTK and MALT1 inhibition augments killing of CD79 mutant diffuse large B cell lymphoma.
26525107 2015 The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-?B signalling.
More...