Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.66
PubTator Score 1.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Dermatitis, Irritant 9 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.4e-05
Atopic dermatitis 952 2.0e-03
psoriasis 6694 2.0e-02
mucosa-associated lymphoid tissue lymphoma 484 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 1.7
Rheumatoid arthritis 1191 0.0 3.0
Disease Target Count Z-score Confidence
Irritant dermatitis 9 3.377 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 1.200 2.0e-03
mucosa-associated lymphoid tissue lympho... 1.011 4.6e-02
osteosarcoma -2.629 1.4e-05
psoriasis 1.600 2.0e-02

Gene RIF (1)

AA Sequence

MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLCKEPFRPGSFR      1 - 70
PNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVVCREAGEHATHTMRFLEDAAA     71 - 140
PYREQIHKCLKCLRKEREEIQEIQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQ    141 - 210
DGDILRQRDEFDLLVAGEICRFSALIEELEEKNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRI    211 - 280
RDFPQQALPLQREMKMFLEKLCFELDYEPAHISLDPQTSHPKLLLSEDHQRAQFSYKWQNSPDNPQRFDR    281 - 350
ATCVLAHTGITGGRHTWVVSIDLAHGGSCTVGVVSEDVQRKGELRLRPEEGVWAVRLAWGFVSALGSFPT    351 - 420
RLTLKEQPRQVRVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS             421 - 481
//

Text Mined References (13)

PMID Year Title