Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.50
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession Q9UDY4 B2R824 Q13431
Symbols DjB4
HLJ1
DNAJW

Gene

PANTHER Protein Class (2)

Gene RIF (12)

PMID Text
24696714 HLJ1 is a strong tumor suppressor for colorectal carcinoma
24318877 we combined the Hsp70-NEF pairs with cochaperones of the J protein family (DnaJA1, DnaJA2, DnaJB1, and DnaJB4) to generate 16 permutations.
24293545 Low expression of DNAJB4 is associated with gastric carcinomas.
23898208 HIV-1 Tat downregulates the expression of DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4) in human primary T cells
23306212 Silencing of HLJ1 partially reverses the inhibition of cancer-cell invasion by andrographolide.
21345358 HBV could promote HLJ1 expression by up-regulating the transcription factor YY1.
20615403 acidic stress increases the association between HLJ1 and beta-actin to modulate migration of human lung cancer cells
20145123 HLJ1 switches the role of NPM1, which can act as tumor suppressor or oncogene, by modulating the oligomerization of NPM1 via HLJ1-NPM1 heterodimer formation and recruiting AP-2alpha to the MMP-2 promoter.
18794131 Results show that curcumin induces HLJ1, through activation of the JNK/JunD pathway, and inhibits lung cancer cell invasion and metastasis by modulating E-cadherin expression.
16788156 HLJ1 is a novel tumor suppressor in NSCLC, and high HLJ1 expression is associated with reduced cancer recurrence and prolonged survival of NSCLC patients.
More...

AA Sequence

MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEE      1 - 70
GLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMN     71 - 140
GYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKE    141 - 210
GTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMS    211 - 280
VNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS                 281 - 337
//

Text Mined References (29)

PMID Year Title
24696714 2014 HLJ1 is a novel biomarker for colorectal carcinoma progression and overall patient survival.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
24293545 2014 DNAJB4 molecular chaperone distinguishes WT from mutant E-cadherin, determining their fate in vitro and in vivo.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23306212 2013 The HLJ1-targeting drug screening identified Chinese herb andrographolide that can suppress tumour growth and invasion in non-small-cell lung cancer.
22529897 2012 Dimethyl sulfoxide promotes the multiple functions of the tumor suppressor HLJ1 through activator protein-1 activation in NSCLC cells.
21345358 2011 Hepatitis B virus protein up-regulated HLJ1 expression via the transcription factor YY1 in human hepatocarcinoma cells.
21269460 2011 Initial characterization of the human central proteome.
21255413 2011 A novel neuron-enriched protein SDIM1 is down regulated in Alzheimer's brains and attenuates cell death induced by DNAJB4 over-expression in neuro-progenitor cells.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
More...