Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
R01 Count 5
Funding $205,906.04
PubMed Score 17.18
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
early-onset Parkinson disease 6 2 4.211 2.1

Expression

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
15155745 MTP18 mRNA as well as protein expression is dependent on PI 3-kinase activity.

AA Sequence

MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPE      1 - 70
AGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHP     71 - 140
IDRSVDFLLDSSLRKLYPTVGKPSSS                                                141 - 166
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15998911 2005 Examples of the complex architecture of the human transcriptome revealed by RACE and high-density tiling arrays.
15985469 2005 The mitochondrial protein MTP18 contributes to mitochondrial fission in mammalian cells.
More...