Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.52
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Silicosis 12 4.105 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
chronic rhinosinusitis -2.330 1.1e-02
cystic fibrosis and chronic rhinosinusit... -2.277 3.6e-02
lung adenocarcinoma -1.700 3.7e-12
medulloblastoma, large-cell 1.100 2.3e-04
psoriasis -1.900 6.7e-08

Gene RIF (2)

AA Sequence

MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYMEFRKTMDIDH      1 - 70
ILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTE     71 - 140
RLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLS    141 - 210
EDTRRKIIVLGNNWKEGLLKLISPEELPAQFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEH    211 - 280
SVQINRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPED    281 - 350
GNLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV                        351 - 400
//

Text Mined References (9)

PMID Year Title