Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.27
PubTator Score 3.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
lung adenocarcinoma -1.700 0.000
chronic rhinosinusitis -2.330 0.011
cystic fibrosis and chronic rhinosinusit... -2.277 0.036
psoriasis -1.900 0.000

Gene RIF (2)

PMID Text
15040456 we report a human SPF/TAP homology SEC14L3 with 2082 base pairs in length and contains an open reading frame encoding a 400 amino acids protein. Analysis shows that SEC14L3 is mapped to 22q12 and expresses only in the liver
15033454 Discusses cloning of rat SEC14-like protein 3 and mentions three human SPF-related genes, known as SEC14-like protein 1, 2 and 3.

AA Sequence

MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYMEFRKTMDIDH      1 - 70
ILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTE     71 - 140
RLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLS    141 - 210
EDTRRKIIVLGNNWKEGLLKLISPEELPAQFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEH    211 - 280
SVQINRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPED    281 - 350
GNLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV                        351 - 400
//

Text Mined References (9)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17428729 2007 The lipid-binding SEC14 domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15040456 2004 Characterization of a human Sec14-like protein cDNA SEC14L3 highly homologous to human SPF/TAP.
15033454 2004 Rat supernatant protein factor-like protein stimulates squalene monooxygenase and is activated by protein kinase A.
12757856 2003 Cloning of novel human SEC14p-like proteins: ligand binding and functional properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.