Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.37
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UDW3 A8K9F6
Symbols ZC3H19
SNRNP20
U11/U12-20K

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGS      1 - 70
NCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYP     71 - 140
VGWPPVQELPPSLRAPPPGGWPLQPRVQWG                                            141 - 170
//

Text Mined References (10)

PMID Year Title