Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.37
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UDW3 A8K9F6
Symbols ZC3H19
SNRNP20
U11/U12-20K

Gene

PANTHER Protein Class (2)

AA Sequence

MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGS      1 - 70
NCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYP     71 - 140
VGWPPVQELPPSLRAPPPGGWPLQPRVQWG                                            141 - 170
//

Text Mined References (10)

PMID Year Title
22807096 2013 Search for chromosome rearrangements: new approaches toward discovery of novel translocations in head and neck squamous cell carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.