Property Summary

NCBI Gene PubMed Count 12
Grant Count 3
Funding $43,137
PubMed Score 7.12
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 0.012
ependymoma -2.000 0.009
oligodendroglioma -1.200 0.029
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.553 0.000
pediatric high grade glioma -1.100 0.000
gastric carcinoma -1.100 0.010
ulcerative colitis -1.100 0.000
ovarian cancer 2.100 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q9UDW1 B5MCM5 Q9T2V6
Symbols QCR9
UCRC
HSPC051
HSPC119
HSPC151
UCCR7.2

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
22277967 Strong candidate gene for mitochondrial disease, based on recessive mutations detected in infantile patients
20877624 Observational study of gene-disease association. (HuGE Navigator)
16054089 Functionality of complex III of the mitochondrial electron transport chain is required for the hypoxic stabilization of HIF-1 alpha and HIF-2 alpha

AA Sequence

MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK             1 - 63
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22277967 2012 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16054089 2005 Mitochondrial complex III is required for hypoxia-induced ROS production and cellular oxygen sensing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
More...