Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.22
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-02
atypical teratoid / rhabdoid tumor -1.800 6.9e-06
ependymoma -2.000 9.4e-03
gastric carcinoma -1.100 9.6e-03
glioblastoma -1.400 9.1e-05
group 4 medulloblastoma -1.100 1.3e-04
medulloblastoma, large-cell -1.400 1.1e-05
oligodendroglioma -1.200 2.9e-02
ovarian cancer 2.100 2.2e-06
pancreatic ductal adenocarcinoma liver m... -1.553 2.9e-04
pediatric high grade glioma -1.100 1.8e-05
pituitary cancer 1.100 3.7e-05
ulcerative colitis -1.100 1.1e-07

Gene RIF (4)

AA Sequence

MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK             1 - 63
//

Text Mined References (16)

PMID Year Title