Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.63
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.4e-07
psoriasis 6694 2.9e-05
lung cancer 4740 8.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.600 8.6e-04
osteosarcoma -1.225 2.4e-07
psoriasis -1.900 2.9e-05

AA Sequence

MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTG      1 - 70
TAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVS     71 - 140
RSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHP    141 - 210
AGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPS    211 - 280
SSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPE    281 - 350
ESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPW    351 - 420
RKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGR    421 - 490
PNGLL                                                                     491 - 495
//

Text Mined References (12)

PMID Year Title