Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.66
PubTator Score 22.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Williams Syndrome 10
Disease Target Count P-value
ulcerative colitis 2087 8.48293934953183E-6
medulloblastoma, large-cell 6234 4.65495732289439E-4
oligodendroglioma 2849 0.00312506003641126
group 3 medulloblastoma 2254 0.0034677566610441
astrocytoma 1493 0.0104359226667943
ependymoma 2514 0.0146249828858979
Disease Target Count Z-score Confidence
Clostridium difficile colitis 12 3.064 1.5
Disease Target Count
Williams-Beuren syndrome 45

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.700 0.010
ependymoma 1.600 0.015
oligodendroglioma 1.600 0.003
medulloblastoma, large-cell -2.100 0.000
group 3 medulloblastoma -1.100 0.003
ulcerative colitis -1.100 0.000

Synonym

Accession Q9UDT6 O14527 O43611
Symbols CLIP
CYLN2
WSCR3
WSCR4
WBSCR3
WBSCR4
CLIP-115

Gene

PDB

2CP2   2CP3  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
25957251 A clear radiation dose-response relationship for the CLIP2 marker expression in post-Chernobyl papillary thyroid carcinomas
25284583 CLIP2 protein expression is elevated in papillary thyroid carcinomas from patients exposed to radioiodine fallout compared with a nonexposed control group.
22608712 CLIP2 haploinsufficiency by itself does not lead to the physical or cognitive characteristics of the Williams-Beuren syndrome; GTF2IRD1 and GTF2I are the main genes causing the cognitive defects
21606360 Data show that gene CLIP2 was specifically overexpressed in the exposed cases.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVAASSKEGSPLHKQSSGPSSSPAAAAAPEKPGPKAAE      1 - 70
VGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFT     71 - 140
RPSKLTRQPTAEGSGSDAHSVESLTAQNLSLHSGTATPPLTSRVIPLRESVLNSSVKTGNESGSNLSDSG    141 - 210
SVKRGEKDLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFA    211 - 280
PIHKVIRIGFPSTSPAKAKKTKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARK    281 - 350
ISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLL    351 - 420
VESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLLLEKAQAERLLRE    421 - 490
LADNRLTTVAEKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAAEILRLRERLLSASKEHQRES    491 - 560
GVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQQATSENMGLMDNWKSKLDSLASDHQKSLED    561 - 630
LKATLNSGPGAQQKEIGELKAVMEGIKMEHQLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQ    631 - 700
RHWRAQLEVQASQHRLELQEAQDQRRDAELRVHELEKLDVEYRGQAQAIEFLKEQISLAEKKMLDYERLQ    701 - 770
RAEAQGKQEVESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRTKETVEGLQDKLNKRDKEVT    771 - 840
ALTSQTEMLRAQVSALESKCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLVLISQELLRKERSLN    841 - 910
ELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSA    911 - 980
PELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH        981 - 1046
//

Text Mined References (22)

PMID Year Title
25957251 2015 Dose-dependent expression of CLIP2 in post-Chernobyl papillary thyroid carcinomas.
25284583 2015 CLIP2 as radiation biomarker in papillary thyroid carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22608712 2012 The contribution of CLIP2 haploinsufficiency to the clinical manifestations of the Williams-Beuren syndrome.
21606360 2011 Gain of chromosome band 7q11 in papillary thyroid carcinomas of young patients is associated with exposure to low-dose irradiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18088087 2008 Phosphoproteome of resting human platelets.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...