Property Summary

NCBI Gene PubMed Count 18
Grant Count 348
R01 Count 173
Funding $82,169,853.81
PubMed Score 15.66
PubTator Score 22.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.700 0.010
ependymoma 1.600 0.015
oligodendroglioma 1.600 0.003
medulloblastoma, large-cell -2.100 0.000
group 3 medulloblastoma -1.100 0.003
ulcerative colitis -1.100 0.000

Synonym

Accession Q9UDT6 O14527 O43611
Symbols CLIP
CYLN2
WSCR3
WSCR4
WBSCR3
WBSCR4
CLIP-115

Gene

PDB

2CP2   2CP3  

Gene RIF (5)

PMID Text
25957251 A clear radiation dose-response relationship for the CLIP2 marker expression in post-Chernobyl papillary thyroid carcinomas
25284583 CLIP2 protein expression is elevated in papillary thyroid carcinomas from patients exposed to radioiodine fallout compared with a nonexposed control group.
22608712 CLIP2 haploinsufficiency by itself does not lead to the physical or cognitive characteristics of the Williams-Beuren syndrome; GTF2IRD1 and GTF2I are the main genes causing the cognitive defects
21606360 Data show that gene CLIP2 was specifically overexpressed in the exposed cases.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVAASSKEGSPLHKQSSGPSSSPAAAAAPEKPGPKAAE      1 - 70
VGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFT     71 - 140
RPSKLTRQPTAEGSGSDAHSVESLTAQNLSLHSGTATPPLTSRVIPLRESVLNSSVKTGNESGSNLSDSG    141 - 210
SVKRGEKDLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFA    211 - 280
PIHKVIRIGFPSTSPAKAKKTKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARK    281 - 350
ISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLL    351 - 420
VESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLLLEKAQAERLLRE    421 - 490
LADNRLTTVAEKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAAEILRLRERLLSASKEHQRES    491 - 560
GVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQQATSENMGLMDNWKSKLDSLASDHQKSLED    561 - 630
LKATLNSGPGAQQKEIGELKAVMEGIKMEHQLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQ    631 - 700
RHWRAQLEVQASQHRLELQEAQDQRRDAELRVHELEKLDVEYRGQAQAIEFLKEQISLAEKKMLDYERLQ    701 - 770
RAEAQGKQEVESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRTKETVEGLQDKLNKRDKEVT    771 - 840
ALTSQTEMLRAQVSALESKCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLVLISQELLRKERSLN    841 - 910
ELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSA    911 - 980
PELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH        981 - 1046
//

Text Mined References (22)

PMID Year Title
25957251 2015 Dose-dependent expression of CLIP2 in post-Chernobyl papillary thyroid carcinomas.
25284583 2015 CLIP2 as radiation biomarker in papillary thyroid carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22608712 2012 The contribution of CLIP2 haploinsufficiency to the clinical manifestations of the Williams-Beuren syndrome.
21606360 2011 Gain of chromosome band 7q11 in papillary thyroid carcinomas of young patients is associated with exposure to low-dose irradiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18088087 2008 Phosphoproteome of resting human platelets.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...