Property Summary

NCBI Gene PubMed Count 16
PubMed Score 30.63
PubTator Score 12.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Hyperlysinemias 1 0.0 0.0
Saccharopinuria 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.9
Disease Target Count
Hyperlysinemia 6

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.200 4.9e-02
astrocytic glioma 1.300 1.8e-02
Astrocytoma, Pilocytic 1.400 2.2e-05
Breast cancer -2.900 2.8e-02
ductal carcinoma in situ -1.200 2.4e-04
ependymoma 1.800 3.6e-02
glioblastoma 1.100 5.0e-04
intraductal papillary-mucinous carcinoma... -1.300 2.8e-02
intraductal papillary-mucinous neoplasm ... -1.700 2.3e-02
invasive ductal carcinoma -1.300 8.5e-04
lung cancer -2.000 9.9e-04
malignant mesothelioma -1.500 1.4e-06
oligodendroglioma 1.300 2.2e-02
ovarian cancer -1.200 6.1e-07
primitive neuroectodermal tumor 1.100 4.2e-03
psoriasis 1.300 1.2e-07

Synonym

Accession Q9UDR5 O95462
Symbols LKRSDH
LORSDH
LKR/SDH

Gene

PDB

5L76   5L78   5O1N   5O1P  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDK      1 - 70
DYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMV     71 - 140
DHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLM    141 - 210
PKSIGPLTFVFTGTGNVSKGAQAIFNELPCEYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYD    211 - 280
PAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFSPAGVEGCPALPHKLV    281 - 350
AICDISADTGGSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLY    351 - 420
PYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGTRRKVLVLGSGY    421 - 490
ISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYNINPVSMDICKQEEKLGFLVAKQDLVISLLPYVLHP    491 - 560
LVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMETIDKAKEVGATIESYI    561 - 630
SYCGGLPAPEHSNNPLRYKFSWSPVGVLMNVMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGY    631 - 700
PNRDSTKYAEIYGISSAHTLLRGTLRYKGYMKALNGFVKLGLINREALPAFRPEANPLTWKQLLCDLVGI    701 - 770
SPSSEHDVLKEAVLKKLGGDNTQLEAAEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRD    771 - 840
SFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFSKEIYGPILER    841 - 910
IKAEGIIYTTQSTIKP                                                          911 - 926
//

Text Mined References (18)

PMID Year Title