Property Summary

NCBI Gene PubMed Count 90
Grant Count 253
R01 Count 127
Funding $40,977,219.32
PubMed Score 537.11
PubTator Score 241.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q9UD71 Q547V9 Q547W0 Q9H7G1
Symbols DARPP32
DARPP-32

Gene

Gene RIF (74)

PMID Text
26818509 Striatal function was indexed by a gene coding for DARPP-32, which is densely expressed in the striatum where it is necessary for synaptic plasticity
26561806 No significant differences in mRNA expression levels of DRD2 and DARPP-32 were found among controls, patients with psychotic disorder not otherwise specified, and schizophrenia/schizophreniform disorder.
26178297 DARPP-32 is mainly cleaved at Thr(153) by calpain and this cleavage of DARPP-32 reduces CREB phosphorylation via loss of its inhibitory function on PP1; results suggest a novel mechanism of DARPP-32-CREB signalling dysregulation in Alzheimer's disease
24704945 The results of this study found that the mean t-DARPP expression level in the caudate was higher in patients with schizophrenia than in control individuals.
24395794 Bcl-2 and DARPP-32 have roles in regulating inositol 1,4,5-trisphosphate receptor phosphorylation and promoting cell survival
24276243 Findings show that PPP1R1B-STARD3 fusion transcript has a key role in subsets of gastric cancers through the activation of PI3K/AKT signaling.
24035787 This study showed that variations in genotypes relevant for DARPP-32 functions are associated more with aging-related impairments in the explicit than the implicit component of sequence learning.
23715974 The immunostaining was more decreased for DARPP-32 than for the morphological changes of striatal neurons in multiple system atrophy.
23639477 The present study provides novel evidence for an association between the DARPP-32 gene (SNP rs907094) and attentional control of auditory perception.
23295814 Results suggest that variation in PPP1R1B affects the abundance of the splice variant t-DARPP-32 mRNA and may reflect potential molecular mechanisms implicated in schizophrenia and affective disorders
More...

AA Sequence

MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPN      1 - 70
PCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAE     71 - 140
VLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT          141 - 204
//

Text Mined References (90)

PMID Year Title
26818509 2016 Variability in Dopamine Genes Dissociates Model-Based and Model-Free Reinforcement Learning.
26561806 2015 The mRNA Expression Status of Dopamine Receptor D2, Dopamine Receptor D3 and DARPP-32 in T Lymphocytes of Patients with Early Psychosis.
26178297 2015 Calpain-mediated cleavage of DARPP-32 in Alzheimer's disease.
25416956 2014 A proteome-scale map of the human interactome network.
24704945 2014 Elevated postmortem striatal t-DARPP expression in schizophrenia and associations with DRD2/ANKK1 polymorphism.
24395794 2014 Feedback regulation mediated by Bcl-2 and DARPP-32 regulates inositol 1,4,5-trisphosphate receptor phosphorylation and promotes cell survival.
24276243 2014 PPP1R1B-STARD3 chimeric fusion transcript in human gastric cancer promotes tumorigenesis through activation of PI3K/AKT signaling.
24035787 2013 Effects of aging and dopamine genotypes on the emergence of explicit memory during sequence learning.
23715974 2013 Loss of DARPP-32 and calbindin in multiple system atrophy.
23639477 2013 Dopamine modulates attentional control of auditory perception: DARPP-32 (PPP1R1B) genotype effects on behavior and cortical evoked potentials.
More...