Property Summary

NCBI Gene PubMed Count 90
PubMed Score 537.11
PubTator Score 241.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Catalepsy 15
Dyskinetic syndrome 6
Disease Target Count P-value
oligodendroglioma 2849 1.44737596037253E-10
psoriasis 6685 4.87519176190567E-9
posterior fossa group A ependymoma 1511 1.42606287832204E-8
astrocytoma 1493 4.0196166376655E-8
glioblastoma 5572 1.04166057056075E-7
pilocytic astrocytoma 3086 2.61982861905152E-7
medulloblastoma, large-cell 6234 4.8654459424967E-7
pediatric high grade glioma 2712 5.84053156679616E-7
atypical teratoid/rhabdoid tumor 1095 6.29505478602767E-7
sonic hedgehog group medulloblastoma 1482 5.06536590386332E-6
interstitial cystitis 2299 8.46754771420555E-4
breast carcinoma 1614 0.0032410923876488
primitive neuroectodermal tumor 3031 0.0144636977289117
urothelial carcinoma 318 0.0161643374781861
subependymal giant cell astrocytoma 2287 0.0346155549272064
chronic rhinosinusitis 512 0.036513021908006
invasive ductal carcinoma 2950 0.0418482781745465

Expression

  Differential Expression (17)

Synonym

Accession Q9UD71 Q547V9 Q547W0 Q9H7G1
Symbols DARPP32
DARPP-32

Gene

  Ortholog (10)

Gene RIF (74)

PMID Text
26818509 Striatal function was indexed by a gene coding for DARPP-32, which is densely expressed in the striatum where it is necessary for synaptic plasticity
26561806 No significant differences in mRNA expression levels of DRD2 and DARPP-32 were found among controls, patients with psychotic disorder not otherwise specified, and schizophrenia/schizophreniform disorder.
26178297 DARPP-32 is mainly cleaved at Thr(153) by calpain and this cleavage of DARPP-32 reduces CREB phosphorylation via loss of its inhibitory function on PP1; results suggest a novel mechanism of DARPP-32-CREB signalling dysregulation in Alzheimer's disease
24704945 The results of this study found that the mean t-DARPP expression level in the caudate was higher in patients with schizophrenia than in control individuals.
24395794 Bcl-2 and DARPP-32 have roles in regulating inositol 1,4,5-trisphosphate receptor phosphorylation and promoting cell survival
24276243 Findings show that PPP1R1B-STARD3 fusion transcript has a key role in subsets of gastric cancers through the activation of PI3K/AKT signaling.
24035787 This study showed that variations in genotypes relevant for DARPP-32 functions are associated more with aging-related impairments in the explicit than the implicit component of sequence learning.
23715974 The immunostaining was more decreased for DARPP-32 than for the morphological changes of striatal neurons in multiple system atrophy.
23639477 The present study provides novel evidence for an association between the DARPP-32 gene (SNP rs907094) and attentional control of auditory perception.
23295814 Results suggest that variation in PPP1R1B affects the abundance of the splice variant t-DARPP-32 mRNA and may reflect potential molecular mechanisms implicated in schizophrenia and affective disorders
More...

AA Sequence

MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPN      1 - 70
PCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAE     71 - 140
VLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT          141 - 204
//

Text Mined References (90)

PMID Year Title
26818509 2016 Variability in Dopamine Genes Dissociates Model-Based and Model-Free Reinforcement Learning.
26561806 2015 The mRNA Expression Status of Dopamine Receptor D2, Dopamine Receptor D3 and DARPP-32 in T Lymphocytes of Patients with Early Psychosis.
26178297 2015 Calpain-mediated cleavage of DARPP-32 in Alzheimer's disease.
25416956 2014 A proteome-scale map of the human interactome network.
24704945 2014 Elevated postmortem striatal t-DARPP expression in schizophrenia and associations with DRD2/ANKK1 polymorphism.
24395794 2014 Feedback regulation mediated by Bcl-2 and DARPP-32 regulates inositol 1,4,5-trisphosphate receptor phosphorylation and promotes cell survival.
24276243 2014 PPP1R1B-STARD3 chimeric fusion transcript in human gastric cancer promotes tumorigenesis through activation of PI3K/AKT signaling.
24035787 2013 Effects of aging and dopamine genotypes on the emergence of explicit memory during sequence learning.
23715974 2013 Loss of DARPP-32 and calbindin in multiple system atrophy.
23639477 2013 Dopamine modulates attentional control of auditory perception: DARPP-32 (PPP1R1B) genotype effects on behavior and cortical evoked potentials.
More...