Property Summary

NCBI Gene PubMed Count 96
PubMed Score 563.15
PubTator Score 241.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 1.1e-03
astrocytoma -1.300 4.0e-08
Astrocytoma, Pilocytic -3.100 3.7e-07
atypical teratoid / rhabdoid tumor -2.000 9.6e-04
breast carcinoma -1.400 3.2e-03
chronic rhinosinusitis 1.236 3.7e-02
glioblastoma -2.700 1.0e-07
group 3 medulloblastoma -2.500 4.3e-05
interstitial cystitis -2.400 5.4e-03
invasive ductal carcinoma -1.096 4.2e-02
medulloblastoma, large-cell -2.700 4.9e-07
oligodendroglioma -1.600 1.4e-10
posterior fossa group A ependymoma 1.700 1.4e-08
primitive neuroectodermal tumor -2.000 1.4e-02
psoriasis -1.200 4.4e-15
subependymal giant cell astrocytoma -2.643 3.5e-02
urothelial carcinoma -1.500 1.6e-02

Protein-protein Interaction (1)

Gene RIF (79)

AA Sequence

MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPN      1 - 70
PCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAE     71 - 140
VLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT          141 - 204
//

Text Mined References (96)

PMID Year Title