Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.32
PubTator Score 1.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 3.6e-06
Disease Target Count Z-score Confidence
Tetralogy of Fallot 67 3.423 1.7

AA Sequence

MLAWQDGGAKAAPSHHKISFSVLDILDPQKFTRAALPAVRPAPREARKSLAEVEAGKDASSRDPVRQLET      1 - 70
PDAAGPGAGQASPLEGSEAEEEEDAEDPRRPRLRERAARLLPGLARSPDAPAGALASGEPCEDGGGGPVR     71 - 140
SPPGSPGSPRPRRRRLEPNCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIW    141 - 210
FQNRRTKWKKQNPGADGAAQVGGGAPQPGAAGGGGGGGSGGSPGPPGTGALHFQTFPSYSAANVLFPSAA    211 - 280
SFPLTAAAPGSPFAPFLGPSYLTPFYAPRL                                            281 - 310
//

Text Mined References (5)

PMID Year Title