Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.32
PubTator Score 1.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

AA Sequence

MLAWQDGGAKAAPSHHKISFSVLDILDPQKFTRAALPAVRPAPREARKSLAEVEAGKDASSRDPVRQLET      1 - 70
PDAAGPGAGQASPLEGSEAEEEEDAEDPRRPRLRERAARLLPGLARSPDAPAGALASGEPCEDGGGGPVR     71 - 140
SPPGSPGSPRPRRRRLEPNCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIW    141 - 210
FQNRRTKWKKQNPGADGAAQVGGGAPQPGAAGGGGGGGSGGSPGPPGTGALHFQTFPSYSAANVLFPSAA    211 - 280
SFPLTAAAPGSPFAPFLGPSYLTPFYAPRL                                            281 - 310
//

Text Mined References (4)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
10681422 2000 The mouse Nkx-1.2 homeobox gene: alternative RNA splicing at canonical and noncanonical splice sites.
7518789 1994 Identification of homeobox genes expressed in human haemopoietic progenitor cells.