Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.54584767864708E-7
pilocytic astrocytoma 3086 2.39716735198754E-6
group 3 medulloblastoma 2254 5.54537870427438E-5
ovarian cancer 8492 2.67627110430822E-4
primitive neuroectodermal tumor 3031 0.00259638599088116

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.000
group 3 medulloblastoma 1.800 0.000
primitive neuroectodermal tumor 1.300 0.003
pilocytic astrocytoma 1.300 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q9UC06
Symbols Cos17

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

AA Sequence

MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLC      1 - 70
SSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPY     71 - 140
ACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSA    141 - 210
LTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPH    211 - 280
ECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSS    281 - 350
LIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYV    351 - 420
CNLCGKSFRGSSHLIRHQKIHSGEKL                                                421 - 446
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1639391 1992 Cloning of six new genes with zinc finger motifs mapping to short and long arms of human acrocentric chromosome 22 (p and q11.2).