Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 3.0e-07
Astrocytoma, Pilocytic 3081 1.9e-06
group 3 medulloblastoma 4104 5.5e-05
ovarian cancer 8520 2.7e-04
primitive neuroectodermal tumor 3035 2.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 1.9e-06
ependymoma 1.200 3.0e-07
group 3 medulloblastoma 1.800 5.5e-05
ovarian cancer -1.500 2.7e-04
primitive neuroectodermal tumor 1.300 2.6e-03

Gene RIF (1)

AA Sequence

MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLC      1 - 70
SSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPY     71 - 140
ACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSA    141 - 210
LTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPH    211 - 280
ECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSS    281 - 350
LIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYV    351 - 420
CNLCGKSFRGSSHLIRHQKIHSGEKL                                                421 - 446
//

Text Mined References (6)

PMID Year Title