Property Summary

NCBI Gene PubMed Count 61
Grant Count 172
R01 Count 133
Funding $17,760,716.44
PubMed Score 269.99
PubTator Score 138.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UBZ9 O95941 Q53SI7 Q9C0J4 Q9NUP2
Symbols REV1L
AIBP80

Gene

PDB

3VU7   4EXT   4GK0   4GK5   2N1G   2EBW   2LSI   2LSK   2LSY   3GQC   4BA9  

 GO Component (1)

Gene RIF (47)

PMID Text
26982350 Data suggest that relatively high affinity binding of PolD3-RIR motif to Rev1-C-terminal domain displaces subunits from PolN, Pol-iota, or PolK from Rev1 complex and promotes formation of Rev1/PolZ4 assembly with PCNA for translesion DNA replication.
26903512 Saccharomyces cerevisiae
26680302 Rev1 is indispensable for Translesion synthesis mediated by Poleta, Poliota, and Polkappa but is not required for TLS by Polzeta.
26318859 Data suggest Rev1 protein recognition mechanism by Fanconi anemia-associated protein 20 (FAAP20).
25614517 show that REV1 is a novel binding partner of the tumor suppressor p53 and regulates its activity
25080294 The molecular mechanism of 3-nitrobenzanthrone genotoxicity in HEK293 cells is reported.
24956248 Our results suggest for the first time that REV1 and REV3L SNPs might serve as potential predictive markers of outcome of cisplatin-based chemotherapy
24409475 Structural studies suggest the possible involvement of XRCC1 and its associated repair factors, REV1 in post replication repair.
24366879 The results show that human Rev1 disrupts G4 DNA structures and prevents refolding in vitro.
23761444 Rev1 but not Poleta depletion is epistatic to the lack of PCNA ubiquitination.
More...

AA Sequence

MRRGGWRKRAENDGWETWGGYMAAKVQKLEEQFRSDAAMQKDGTSSTIFSGVAIYVNGYTDPSAEELRKL      1 - 70
MMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKAGRLLSYIPYQLYTKQSSVQK     71 - 140
GLSFNPVCRPEDPLPGPSNIAKQLNNRVNHIVKKIETENEVKVNGMNSWNEEDENNDFSFVDLEQTSPGR    141 - 210
KQNGIPHPRGSTAIFNGHTPSSNGALKTQDCLVPMVNSVASRLSPAFSQEEDKAEKSSTDFRDCTLQQLQ    211 - 280
QSTRNTDALRNPHRTNSFSLSPLHSNTKINGAHHSTVQGPSSTKSTSSVSTFSKAAPSVPSKPSDCNFIS    281 - 350
NFYSHSRLHHISMWKCELTEFVNTLQRQSNGIFPGREKLKKMKTGRSALVVTDTGDMSVLNSPRHQSCIM    351 - 420
HVDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAADIPDSSLWEN    421 - 490
PDSAQANGIDSVLSRAEIASCSYEARQLGIKNGMFFGHAKQLCPNLQAVPYDFHAYKEVAQTLYETLASY    491 - 560
THNIEAVSCDEALVDITEILAETKLTPDEFANAVRMEIKDQTKCAASVGIGSNILLARMATRKAKPDGQY    561 - 630
HLKPEEVDDFIRGQLVTNLPGVGHSMESKLASLGIKTCGDLQYMTMAKLQKEFGPKTGQMLYRFCRGLDD    631 - 700
RPVRTEKERKSVSAEINYGIRFTQPKEAEAFLLSLSEEIQRRLEATGMKGKRLTLKIMVRKPGAPVETAK    701 - 770
FGGHGICDNIARTVTLDQATDNAKIIGKAMLNMFHTMKLNISDMRGVGIHVNQLVPTNLNPSTCPSRPSV    771 - 840
QSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAAVDLEISSASRTCTFLPPFPAHLPTSPDTNKAESS    841 - 910
GKWNGLHTPVSVQSRLNLSIEVPSPSQLDQSVLEALPPDLREQVEQVCAVQQAESHGDKKKEPVNGCNTG    911 - 980
ILPQPVGTVLLQIPEPQESNSDAGINLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQ    981 - 1050
SASASVPKNPLLHLKAAVKEKKRNKKKKTIGSPKRIQSPLNNKLLNSPAKTLPGACGSPQKLIDGFLKHE   1051 - 1120
GPPAEKPLEELSASTSGVPGLSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQV   1121 - 1190
VKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT            1191 - 1251
//

Text Mined References (62)

PMID Year Title
26982350 2016 Interaction between the Rev1 C-Terminal Domain and the PolD3 Subunit of Pol? Suggests a Mechanism of Polymerase Exchange upon Rev1/Pol?-Dependent Translesion Synthesis.
26903512 2016 The Proliferating Cell Nuclear Antigen (PCNA)-interacting Protein (PIP) Motif of DNA Polymerase ? Mediates Its Interaction with the C-terminal Domain of Rev1.
26680302 2015 Rev1 promotes replication through UV lesions in conjunction with DNA polymerases ?, ?, and ? but not DNA polymerase ?.
26318859 2015 Biophysical characterization of the interaction between FAAP20-UBZ4 domain and Rev1-BRCT domain.
25614517 2015 Starvation promotes REV1 SUMOylation and p53-dependent sensitization of melanoma and breast cancer cells.
25080294 2014 Mutational analysis of the C8-guanine adduct of the environmental carcinogen 3-nitrobenzanthrone in human cells: critical roles of DNA polymerases ? and ? and Rev1 in error-prone translesion synthesis.
24956248 2014 Polymorphisms in translesion polymerase genes influence treatment outcome in malignant mesothelioma.
24409475 2013 XRCC1 interaction with the REV1 C-terminal domain suggests a role in post replication repair.
24366879 2014 Human Rev1 polymerase disrupts G-quadruplex DNA.
23761444 2013 DNA-damage tolerance mediated by PCNA*Ub fusions in human cells is dependent on Rev1 but not Pol?.
More...