Property Summary

NCBI Gene PubMed Count 13
PubMed Score 38.61
PubTator Score 40.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 5.19272927919466E-6
malignant mesothelioma 3163 9.59592516582381E-6
Disease Target Count Z-score Confidence
Radiculopathy 15 3.797 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -1.738 0.000

Synonym

Accession Q9UBZ4 Q9Y5X7
Symbols APE2
XTH2
ZGRF2
APEXL2

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
20522537 Observational study of gene-disease association. (HuGE Navigator)
19443450 Ape2 may be involved in repair of oxidative DNA damage and PCNA-dependent repair synthesis.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
16687656 Ape2 exhibits strong 3'-5' exonuclease and 3'-phosphodiesterase activities and has only a very weak AP-endonuclease activity.
11866537 Determinants in nuclease specificity of Ape1 and Ape2, human homologues of Escherichia coli exonuclease III

AA Sequence

MLRVVSWNINGIRRPLQGVANQEPSNCAAVAVGRILDELDADIVCLQETKVTRDALTEPLAIVEGYNSYF      1 - 70
SFSRNRSGYSGVATFCKDNATPVAAEEGLSGLFATQNGDVGCYGNMDEFTQEELRALDSEGRALLTQHKI     71 - 140
RTWEGKEKTLTLINVYCPHADPGRPERLVFKMRFYRLLQIRAEALLAAGSHVIILGDLNTAHRPIDHWDA    141 - 210
VNLECFEEDPGRKWMDSLLSNLGCQSASHVGPFIDSYRCFQPKQEGAFTCWSAVTGARHLNYGSRLDYVL    211 - 280
GDRTLVIDTFQASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSP    281 - 350
VLEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRGQKNLKSYFQPSPSCPQASPDIELPSLPLMSA    351 - 420
LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCGGHREPCVMRTVKKPGPNLGR    421 - 490
RFYMCARPRGPPTDPSSRCNFFLWSRPS                                              491 - 518
//

Text Mined References (14)

PMID Year Title
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19443450 2009 Role of PCNA-dependent stimulation of 3'-phosphodiesterase and 3'-5' exonuclease activities of human Ape2 in repair of oxidative DNA damage.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16687656 2006 Human Ape2 protein has a 3'-5' exonuclease activity that acts preferentially on mismatched base pairs.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...