Property Summary

NCBI Gene PubMed Count 13
Grant Count 13
R01 Count 10
Funding $1,281,994.5
PubMed Score 38.61
PubTator Score 40.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -1.738 0.000

Gene RIF (5)

PMID Text
20522537 Observational study of gene-disease association. (HuGE Navigator)
19443450 Ape2 may be involved in repair of oxidative DNA damage and PCNA-dependent repair synthesis.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
16687656 Ape2 exhibits strong 3'-5' exonuclease and 3'-phosphodiesterase activities and has only a very weak AP-endonuclease activity.
11866537 Determinants in nuclease specificity of Ape1 and Ape2, human homologues of Escherichia coli exonuclease III

AA Sequence

MLRVVSWNINGIRRPLQGVANQEPSNCAAVAVGRILDELDADIVCLQETKVTRDALTEPLAIVEGYNSYF      1 - 70
SFSRNRSGYSGVATFCKDNATPVAAEEGLSGLFATQNGDVGCYGNMDEFTQEELRALDSEGRALLTQHKI     71 - 140
RTWEGKEKTLTLINVYCPHADPGRPERLVFKMRFYRLLQIRAEALLAAGSHVIILGDLNTAHRPIDHWDA    141 - 210
VNLECFEEDPGRKWMDSLLSNLGCQSASHVGPFIDSYRCFQPKQEGAFTCWSAVTGARHLNYGSRLDYVL    211 - 280
GDRTLVIDTFQASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSP    281 - 350
VLEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRGQKNLKSYFQPSPSCPQASPDIELPSLPLMSA    351 - 420
LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCGGHREPCVMRTVKKPGPNLGR    421 - 490
RFYMCARPRGPPTDPSSRCNFFLWSRPS                                              491 - 518
//

Text Mined References (14)

PMID Year Title
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19443450 2009 Role of PCNA-dependent stimulation of 3'-phosphodiesterase and 3'-5' exonuclease activities of human Ape2 in repair of oxidative DNA damage.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16687656 2006 Human Ape2 protein has a 3'-5' exonuclease activity that acts preferentially on mismatched base pairs.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...