Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.69
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma -2.200 2.0e-03
colon cancer -1.800 1.2e-06
dermatomyositis -1.800 9.5e-04
ductal carcinoma in situ -4.000 2.1e-04
fibroadenoma -3.200 1.4e-02
invasive ductal carcinoma -4.200 1.2e-03
lung adenocarcinoma -1.200 2.2e-14
malignant mesothelioma -4.900 7.7e-10
osteosarcoma 1.957 5.3e-03
posterior fossa group A ependymoma 1.100 3.9e-04
psoriasis -1.600 5.1e-47

Gene RIF (14)

AA Sequence

MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPG      1 - 70
GAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA     71 - 140
LREDGSLTIRARRHPHTEHVQQTFRTEIKI                                            141 - 170
//

Text Mined References (22)

PMID Year Title