Property Summary

NCBI Gene PubMed Count 26
PubMed Score 37.61
PubTator Score 32.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Ceroid lipofuscinosis, neuronal 8 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Lipid storage disease 8 0.0 1.7
Disease Target Count Z-score Confidence
Neuronal ceroid lipofuscinosis 8 1 0.0 5.0
Disease Target Count Z-score Confidence
Visual pathway disease 4 4.354 2.2
Blindness 88 3.171 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis -1.003 6.4e-03
chronic rhinosinusitis -1.188 3.2e-02
cystic fibrosis -1.300 8.0e-04
group 4 medulloblastoma -1.400 8.0e-04
invasive ductal carcinoma -1.200 1.9e-02
lung cancer -1.100 1.2e-02
malignant mesothelioma 2.900 3.4e-07
medulloblastoma, large-cell -1.100 1.6e-04
osteosarcoma 1.729 3.3e-05
Pick disease 1.400 3.5e-05
psoriasis -2.200 3.3e-04
tuberculosis -1.400 5.4e-06

Gene RIF (10)

AA Sequence

MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLNATYRSLVAREKVFWDLAATR      1 - 70
AVFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAVHLSNLIFRTFDLFLVIHHL     71 - 140
FAFLGFLGCLVNLQAGHYLAMTTLLLEMSTPFTCVSWMLLKAGWSESLFWKLNQWLMIHMFHCRMVLTYH    141 - 210
MWWVCFWHWDGLVSSLYLPHLTLFLVGLALLTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEGNGQL    211 - 280
LRKKRP                                                                    281 - 286
//

Text Mined References (27)

PMID Year Title