Property Summary

Ligand Count 28
NCBI Gene PubMed Count 46
PubMed Score 131.86
PubTator Score 104.10

Knowledge Summary

Patent (12,011)

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 2.249 7.3e-04
astrocytic glioma -1.200 4.5e-02
cystic fibrosis 1.925 1.6e-05
Endometriosis -1.353 2.6e-02
ependymoma 1.600 1.2e-04
interstitial cystitis -1.800 3.2e-02
intraductal papillary-mucinous adenoma (... -2.600 2.9e-05
intraductal papillary-mucinous carcinoma... -2.700 1.7e-05
intraductal papillary-mucinous neoplasm ... -2.600 9.9e-04
lung adenocarcinoma -1.100 1.1e-08
medulloblastoma, large-cell 1.200 2.3e-03
non-small cell lung cancer 1.112 3.7e-10
osteosarcoma 1.209 3.9e-02
ovarian cancer 1.200 4.9e-09
pancreatic cancer -1.200 8.6e-03

Gene RIF (29)

AA Sequence

MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRKFHFPFYYLLA      1 - 70
NLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNLLVIAVERHMSIMRMRVHSNL     71 - 140
TKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLAPIYSRSYLVFWTVSNLMAFLIMVVVYLRIY    141 - 210
VYVKRKTNVLSPHTSGSISRRRTPMKLMKTVMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLL    211 - 280
LALLNSVVNPIIYSYKDEDMYGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNK    281 - 350
STS                                                                       351 - 353
//

Text Mined References (46)

PMID Year Title