Property Summary

NCBI Gene PubMed Count 45
Grant Count 41
R01 Count 28
Funding $2,903,043.33
PubMed Score 131.17
PubTator Score 104.10

Knowledge Summary

Patent (12,011)

Expression

Gene RIF (28)

PMID Text
26440309 Expression profiles reveal LPAR3 (lysophosphatidic acid receptor 3) as a mediator for mitotic phosphorylation-driven pancreatic cell motility and invasion. Together, this work identifies YAP as a novel regulator of pancreatic cancer cell motility, invasion and metastasis.
25463482 Suggest that LPA2 and LPA3 may function as a molecular switch and play opposing roles during megakaryopoiesis of K562 cells.
25209561 These data indicated that the expression of LPA receptor 3 was increased in human triple-negative breast cancers and is associated with tumor metastatic ability.
24928086 The results demonstrate LPA-stimulated migration in oral carcinoma cells through LPAR3, mediated further by PKC, which acts either in concert with or independently of EGFR transactivation
24061591 LPA3 mRNA is clearly expressed in human PANC-1 tumor cells.
23569130 Lysophosphatidic acid (LPA) increased hepatocellular carcinoma cells cell invasion, which was LPA-receptor dependent.
23508014 Findings indicate lysophosphatidic acid (LPA)-lysophosphatidic acid receptor-Galpha13 signaling node as a therapeutic target for pancreatic cancer treatment and control.
23167620 The results indicated that LPA(3) acts as a positive regulator of cell motility and invasion in sarcoma cells, suggesting that LPA signaling pathway via LPA(3) may be involved in the progression of sarcoma cells.
22922883 High LPAR3 expression is associated with aggressiveness of breast carcinoma.
22872026 in the normal human menstrual cycle, lysophosphatidic acid receptor 3 messenger RNA and protein expression change, indicating that this gene may be related to the function of the endometrium.
More...

AA Sequence

MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRKFHFPFYYLLA      1 - 70
NLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNLLVIAVERHMSIMRMRVHSNL     71 - 140
TKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLAPIYSRSYLVFWTVSNLMAFLIMVVVYLRIY    141 - 210
VYVKRKTNVLSPHTSGSISRRRTPMKLMKTVMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLL    211 - 280
LALLNSVVNPIIYSYKDEDMYGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNK    281 - 350
STS                                                                       351 - 353
//

Text Mined References (45)

PMID Year Title
26440309 2015 Active YAP promotes pancreatic cancer cell motility, invasion and tumorigenesis in a mitotic phosphorylation-dependent manner through LPAR3.
25463482 2015 Opposing regulation of megakaryopoiesis by LPA receptors 2 and 3 in K562 human erythroleukemia cells.
25209561 2015 Aberrant expression and potential therapeutic target of lysophosphatidic acid receptor 3 in triple-negative breast cancers.
24928086 2014 Role of LPAR3, PKC and EGFR in LPA-induced cell migration in oral squamous carcinoma cells.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
24061591 2013 Lysophosphatidic acid stimulates activation of focal adhesion kinase and paxillin and promotes cell motility, via LPA1-3, in human pancreatic cancer.
23569130 2013 Enhancement of invasion of hepatocellular carcinoma cells through lysophosphatidic acid receptor.
23508014 2013 The gep proto-oncogene G?13 mediates lysophosphatidic acid-mediated migration of pancreatic cancer cells.
23167620 2012 Loss of lysophosphatidic acid receptor-3 suppresses cell migration activity of human sarcoma cells.
More...