Property Summary

NCBI Gene PubMed Count 30
PubMed Score 112.89
PubTator Score 45.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer -1.300 3.3e-02
intraductal papillary-mucinous adenoma (... 3.500 5.2e-05
intraductal papillary-mucinous carcinoma... 2.700 7.3e-03
intraductal papillary-mucinous neoplasm ... 1.900 3.2e-02
lung cancer 1.600 1.2e-02
psoriasis -2.100 3.0e-67
ulcerative colitis -1.200 6.7e-04

Gene RIF (13)

AA Sequence

MEPLGNWRSLRAPLPPMLLLLLLQVAGPVGALAETLLNAPRAMGTSSSPPSPASVVAPGTTLFEESRLPV      1 - 70
FTLDYPHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLLLGGIIFGVDEKSPPAMKTDV     71 - 140
FFLYLLPPIVLDAGYFMPTRPFFENIGTIFWYAVVGTLWNSIGIGVSLFGICQIEAFGLSDITLLQNLLF    141 - 210
GSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIANFFV    211 - 280
VGIGGVLIGIFLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEEN    281 - 350
VSQKSYTTIKYFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRFR    351 - 420
TIPLTFKDQFIIAYGGLRGAICFALVFLLPAAVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKR    421 - 490
SNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNFWRDKFKKFDDKYLRKLLIRENQPKSSIVSLYKKLE    491 - 560
IKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDEIRELLSRNLYQIRQRTLSYNRHSLTADTSE    561 - 630
RQAKEILIRRRHSLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADA    631 - 700
GTTVLNLQPRARRFLPEQFSKKSPQSYKMEWKNEVDVDSGRDMPSTPPTPHSREKGTQTSGLLQQPLLSK    701 - 770
DQSGSEREDSLTEGIPPKPPPRLVWRASEPGSRKARFGSEKP                                771 - 812
//

Text Mined References (32)

PMID Year Title