Property Summary

NCBI Gene PubMed Count 29
Grant Count 101
R01 Count 71
Funding $8,319,767.54
PubMed Score 77.76
PubTator Score 45.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UBY0 B2RMS2
Symbols NHE2

Gene

Gene RIF (12)

PMID Text
24874739 EIPA, a potent and specific inhibitor of Na+/H+ exchanger activity, significantly inhibits the Nef internalization into M2-macrophages, indicating that Nef is imported by Na+/H+ exchanger (solute carrier family 9, subfamily A)
24376510 These data indicate that the acid-dependent NHE2 stimulation is implemented by transcriptional upregulation of NHE2 via acid-induced Egr-1 in the intestinal epithelial cells.
22052014 Phosphorylation of nPKC-delta results in activation of ERK1/2 kinase and subsequent induction of Egr-1. Subsequently, Egr-1 directly targets NHE2 promoter and promotes NHE2 transcriptional upregulation by interaction with NHE2-PMA response element.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19479940 The functional and molecular expression of NHEs in cultured human endolymphatic sac (ES) epithelial cells was determined and the effect of IFN-gamma on NHE function, was examined.
19389806 Report morphological adaptation with preserved proliferation/NHE2 content in the colon of patients with short bowel syndrome.
19056765 Functional coupling of the downregulated in adenoma Cl-/base exchanger DRA and the apical Na+/H+ exchangers NHE2 and NHE3 in intestinal epithelial cells.
17943310 T84 human colon cells contain three isoforms of the Na+/H+ exchanger, NHE1, NHE2, and NHE4, but not the Cl-dependent NHE
17881426 No mutation was found in the coding regions and intron-exon boundaries of the genes for CA II, CA IV, CA XIV, kNCB1, NHE3, NHE8, NHRF1, NHRF2 and SLC26A6 amplified from genomic DNA of family members with pRTA.
17561809 expression of the human NHE2 promoter is controlled by Sp1 and Sp3 by interactions with the proximal promoter and the transcription initiation site of NHE2
More...

AA Sequence

MEPLGNWRSLRAPLPPMLLLLLLQVAGPVGALAETLLNAPRAMGTSSSPPSPASVVAPGTTLFEESRLPV      1 - 70
FTLDYPHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLLLGGIIFGVDEKSPPAMKTDV     71 - 140
FFLYLLPPIVLDAGYFMPTRPFFENIGTIFWYAVVGTLWNSIGIGVSLFGICQIEAFGLSDITLLQNLLF    141 - 210
GSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIANFFV    211 - 280
VGIGGVLIGIFLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEEN    281 - 350
VSQKSYTTIKYFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRFR    351 - 420
TIPLTFKDQFIIAYGGLRGAICFALVFLLPAAVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKR    421 - 490
SNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNFWRDKFKKFDDKYLRKLLIRENQPKSSIVSLYKKLE    491 - 560
IKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDEIRELLSRNLYQIRQRTLSYNRHSLTADTSE    561 - 630
RQAKEILIRRRHSLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADA    631 - 700
GTTVLNLQPRARRFLPEQFSKKSPQSYKMEWKNEVDVDSGRDMPSTPPTPHSREKGTQTSGLLQQPLLSK    701 - 770
DQSGSEREDSLTEGIPPKPPPRLVWRASEPGSRKARFGSEKP                                771 - 812
//

Text Mined References (31)

PMID Year Title
25486439 2015 Gene expression in the human endolymphatic sac: the solute carrier molecules in endolymphatic fluid homeostasis.
25423035 2014 Predictive gene signatures: molecular markers distinguishing colon adenomatous polyp and carcinoma.
25406947 2014 Meta-analysis of human methylation data for evidence of sex-specific autosomal patterns.
24376510 2013 Extracellular acidosis stimulates NHE2 expression through activation of transcription factor Egr-1 in the intestinal epithelial cells.
22052014 2012 PKC?-dependent activation of ERK1/2 leads to upregulation of the human NHE2 transcriptional activity in intestinal epithelial cell line C2BBe1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19479940 2009 Interferon-gamma suppresses Na+ -H+ exchanger in cultured human endolymphatic sac epithelial cells.
19389806 2009 Morphological adaptation with preserved proliferation/transporter content in the colon of patients with short bowel syndrome.
19056765 2009 Functional coupling of the downregulated in adenoma Cl-/base exchanger DRA and the apical Na+/H+ exchangers NHE2 and NHE3.
17943310 2008 NHE1, NHE2, and NHE4 contribute to regulation of cell pH in T84 colon cancer cells.
More...