Property Summary

NCBI Gene PubMed Count 39
Grant Count 8
R01 Count 7
Funding $613,402.6
PubMed Score 252.60
PubTator Score 109.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
25123036 KLK11 mRNA expression could be considered as a new molecular prognostic biomarker in colorectal adenocarcinoma
24288670 The aim of this study was to monitor serum levels of two microRNAs (miR-21 and miR-141) and three kallikreins (hK3/PSA, hK11, and hK13) before and 1, 5, and 30 days after radical prostatectomy.
24169449 hK11 expression in gastric cancer appears to be associated with a better prognosis. hK11 may be a prognostic biomarker of gastric cancer.
23647300 HOXB8 and KLK11 may be classified as valuable biomarkers, as they can predict the effects of FOLFOX4 chemotherapy in primary advanced colorectal cancer patients
23639975 Our data showed that UVB-induced TSLP might increase secretion of the T-helper type 2-attracting chemokine (c-c motif) ligand 17 by human dendritic cells.
23602830 Human airway trypsin-like protease can stimulate mucin5AC hypersecretion through a PAR2-mediated signaling pathway in 16HBE cells.
22429520 Patients harboring KLK11-positive tumors had a significantly decreased risk of death.
21618246 Low KLK11 protein expression is associated with gastric cancer.
21520985 For the first time, we report lower expression of KLK11 in CaP compared to BPH and slight upregulation of KLK11 in advanced tumors compared to localized ones
20424135 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAA      1 - 70
LFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHR     71 - 140
NDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAY    141 - 210
PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMK    211 - 280
NN                                                                        281 - 282
//

Text Mined References (40)

PMID Year Title
25123036 2014 KLK11 mRNA expression predicts poor disease-free and overall survival in colorectal adenocarcinoma patients.
24288670 2013 Circulating microRNAs and kallikreins before and after radical prostatectomy: are they really prostate cancer markers?
24169449 2013 Is human kallikrein-11 in gastric cancer treated with surgery and adjuvant chemoradiotherapy associated with survival?
23647300 2013 Identification of HOXB8 and KLK11 expression levels as potential biomarkers to predict the effects of FOLFOX4 chemotherapy.
23639975 2013 UVB induces HIF-1?-dependent TSLP expression via the JNK and ERK pathways.
23602830 2013 Human airway trypsin-like protease induces mucin5AC hypersecretion via a protease-activated receptor 2-mediated pathway in human airway epithelial cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22429520 2012 Diagnostic and prognostic significance of human kallikrein 11 (KLK11) mRNA expression levels in patients with laryngeal cancer.
21618246 2011 Identification and validation of Kallikrein-ralated peptidase 11 as a novel prognostic marker of gastric cancer based on immunohistochemistry.
21520985 2011 Immunohistochemical localization and analysis of kallikrein-related peptidase 7 and 11 expression in paired cancer and benign foci in prostate cancer patients.
More...