Property Summary

NCBI Gene PubMed Count 42
PubMed Score 259.39
PubTator Score 109.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
colon cancer 2.000 2.5e-02
esophageal adenocarcinoma -2.700 2.2e-02
gastric carcinoma -4.000 2.7e-02
inflammatory breast cancer -2.800 3.5e-04
intraductal papillary-mucinous carcinoma... -1.400 4.0e-02
intraductal papillary-mucinous neoplasm ... -1.100 3.8e-02
lung adenocarcinoma -2.200 3.3e-05
non primary Sjogren syndrome sicca 1.100 3.2e-02
ovarian cancer -3.600 2.9e-09
pancreatic cancer -1.500 9.9e-03
pituitary cancer -1.300 2.8e-03
primary pancreatic ductal adenocarcinoma -1.434 8.0e-03
ulcerative colitis 1.300 8.6e-03

Gene RIF (28)

AA Sequence

MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAA      1 - 70
LFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHR     71 - 140
NDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAY    141 - 210
PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMK    211 - 280
NN                                                                        281 - 282
//

Text Mined References (43)

PMID Year Title