Property Summary

NCBI Gene PubMed Count 88
PubMed Score 204.17
PubTator Score 113.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
non-small cell lung cancer 2798 4.90562909605149E-22
lung carcinoma 2844 4.08106972863913E-17
lung adenocarcinoma 2714 1.93812620613498E-10
posterior fossa group B ependymoma 1530 9.99484209722008E-9
malignant mesothelioma 3163 2.52179462487126E-8
adrenocortical carcinoma 1427 8.86485965787645E-7
lung cancer 4473 1.2147776131093E-6
pilocytic astrocytoma 3086 1.98078555668194E-6
breast carcinoma 1614 8.12228508947969E-6
tuberculosis and treatment for 6 months 686 2.19017775454373E-4
ductal carcinoma in situ 1745 3.08496215843411E-4
invasive ductal carcinoma 2950 4.5372996469801E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.61757232390829E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.97465484169781E-4
pituitary cancer 1972 9.27997510049792E-4
sonic hedgehog group medulloblastoma 1482 0.00123341150428097
psoriasis 6685 0.0017495296248951
Atopic dermatitis 944 0.00194609825612915
non-inflammatory breast cancer 208 0.00197677228147594
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00268317691809005
pediatric high grade glioma 2712 0.00840866861739509
colon cancer 1475 0.0220487037914941
Disease Target Count Z-score Confidence
Cutis laxa 28 6.603 3.3

Expression

Synonym

Accession Q9UBX5 O75966 Q6IAL4 Q6UWA3 FIBL-5
Symbols EVEC
UP50
ADCL2
ARMD3
DANCE
ARCL1A
FIBL-5
HNARMD

Gene

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (64)

PMID Text
26577699 Data indicate that Fbln5 promotes PDAC progression by functioning as a molecular rheostat that modulates cell-ECM interactions to reduce ROS production, and thus tip the balance in favor of tumor cell survival and treatment-refractory disease.
26506560 FBLN5 mRNA expression is upregulated in response to cAMP-mediated decidualization of primary human endometrial stromal cells, although FBLN5 itself does not enhance decidualization
26494967 Lower FBLN-5 expression is an important indicator of poor survival in hepatocellular carcinoma. FBLN-5 inhibits HCC adhesion/motility via integrin-dependent mechanism.
26251522 Fibulin-5 is significantly down-regulated in ovarian carcinoma and acts as a tumour suppressor by inhibiting the migration and invasion of ovarian cancer cells.
26095157 study demonstrates the pivotal role of the extracellular protein, fibulin-5, on the adhesion and proliferation of human keloid-derived cells, through binding to integrin beta-1
25909283 Data suggest that fibulin-5 functions as a metastasis suppressor in lung cancer by modulating tumor microenvironment to suppress Wnt/beta-catenin signaling.
25891043 Fibulin-5 may be implicated in the aetiology of rectal prolapse in a subgroup of young male patients.
25845228 Fibulin-5 plays critical roles in proliferation, migration and invasion of certain tumors, and the effect of fibulin-5 on tumorigenesis appears to be largely context-dependent. (Review)
25807371 Fibulin-5 expression is a disease marker of hepatic fibrosis.
25792650 Up-regulation of elastin and fibulin-5 mRNA levels in ICA were strongly correlated with family history of cardiovascular disease when compared to CCA
More...

AA Sequence

MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIP      1 - 70
RTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNP     71 - 140
TQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNE    141 - 210
CATENPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILL    211 - 280
DDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILY    281 - 350
RDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDL    351 - 420
EMITVNTVINFRGSSVIRLRIYVSQYPF                                              421 - 448
//

Text Mined References (90)

PMID Year Title
26577699 2015 Fibulin-5 Blocks Microenvironmental ROS in Pancreatic Cancer.
26506560 2015 Fibulin-5 is upregulated in decidualized human endometrial stromal cells and promotes primary human extravillous trophoblast outgrowth.
26494967 2015 Effect of fibulin-5 on adhesion, migration and invasion of hepatocellular carcinoma cells via an integrin-dependent mechanism.
26251522 2016 Fibulin-5 is a tumour suppressor inhibiting cell migration and invasion in ovarian cancer.
26095157 2016 Fibulin-5 regulates keloid-derived fibroblast-like cells through integrin beta-1.
25909283 2015 Fibulin-5 inhibits Wnt/?-catenin signaling in lung cancer.
25891043 2015 Expression of fibulin-5 in the skin of patients with rectal prolapse.
25845228 [Diverse functions of fibulin-5 in tumors].
25807371 2015 Analysis of disease-associated protein expression using quantitative proteomics—fibulin-5 is expressed in association with hepatic fibrosis.
25792650 Gene expression levels of elastin and fibulin-5 according to differences between carotid plaque regions.
More...