Property Summary

NCBI Gene PubMed Count 96
PubMed Score 217.09
PubTator Score 113.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -2.697 8.9e-07
Astrocytoma, Pilocytic 1.700 2.2e-06
Atopic dermatitis -1.500 1.9e-03
breast carcinoma -1.900 8.1e-06
colon cancer -1.900 2.2e-02
ductal carcinoma in situ -1.900 3.1e-04
ependymoma 2.000 1.2e-05
intraductal papillary-mucinous adenoma (... -2.500 4.6e-04
intraductal papillary-mucinous carcinoma... -2.700 5.0e-04
intraductal papillary-mucinous neoplasm ... -3.000 2.7e-03
invasive ductal carcinoma -1.502 2.6e-03
lung adenocarcinoma -1.300 5.3e-10
lung cancer -3.300 1.2e-06
lung carcinoma -2.200 4.1e-17
malignant mesothelioma -5.400 2.5e-08
non-inflammatory breast cancer -1.500 2.0e-03
non-small cell lung cancer -2.369 4.9e-22
pediatric high grade glioma 1.100 8.4e-03
pituitary cancer -1.800 9.3e-04
psoriasis -1.200 1.1e-03
sonic hedgehog group medulloblastoma 1.300 1.2e-03
tuberculosis and treatment for 6 months -1.500 2.2e-04

Gene RIF (70)

AA Sequence

MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIP      1 - 70
RTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNP     71 - 140
TQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNE    141 - 210
CATENPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILL    211 - 280
DDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILY    281 - 350
RDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDL    351 - 420
EMITVNTVINFRGSSVIRLRIYVSQYPF                                              421 - 448
//

Text Mined References (98)

PMID Year Title