Property Summary

NCBI Gene PubMed Count 88
Grant Count 59
R01 Count 49
Funding $6,008,993.68
PubMed Score 204.17
PubTator Score 113.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (64)

PMID Text
26577699 Data indicate that Fbln5 promotes PDAC progression by functioning as a molecular rheostat that modulates cell-ECM interactions to reduce ROS production, and thus tip the balance in favor of tumor cell survival and treatment-refractory disease.
26506560 FBLN5 mRNA expression is upregulated in response to cAMP-mediated decidualization of primary human endometrial stromal cells, although FBLN5 itself does not enhance decidualization
26494967 Lower FBLN-5 expression is an important indicator of poor survival in hepatocellular carcinoma. FBLN-5 inhibits HCC adhesion/motility via integrin-dependent mechanism.
26251522 Fibulin-5 is significantly down-regulated in ovarian carcinoma and acts as a tumour suppressor by inhibiting the migration and invasion of ovarian cancer cells.
26095157 study demonstrates the pivotal role of the extracellular protein, fibulin-5, on the adhesion and proliferation of human keloid-derived cells, through binding to integrin beta-1
25909283 Data suggest that fibulin-5 functions as a metastasis suppressor in lung cancer by modulating tumor microenvironment to suppress Wnt/beta-catenin signaling.
25891043 Fibulin-5 may be implicated in the aetiology of rectal prolapse in a subgroup of young male patients.
25845228 Fibulin-5 plays critical roles in proliferation, migration and invasion of certain tumors, and the effect of fibulin-5 on tumorigenesis appears to be largely context-dependent. (Review)
25807371 Fibulin-5 expression is a disease marker of hepatic fibrosis.
25792650 Up-regulation of elastin and fibulin-5 mRNA levels in ICA were strongly correlated with family history of cardiovascular disease when compared to CCA
More...

AA Sequence

MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIP      1 - 70
RTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNP     71 - 140
TQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNE    141 - 210
CATENPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILL    211 - 280
DDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILY    281 - 350
RDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDL    351 - 420
EMITVNTVINFRGSSVIRLRIYVSQYPF                                              421 - 448
//

Text Mined References (90)

PMID Year Title
26577699 2015 Fibulin-5 Blocks Microenvironmental ROS in Pancreatic Cancer.
26506560 2015 Fibulin-5 is upregulated in decidualized human endometrial stromal cells and promotes primary human extravillous trophoblast outgrowth.
26494967 2015 Effect of fibulin-5 on adhesion, migration and invasion of hepatocellular carcinoma cells via an integrin-dependent mechanism.
26251522 2016 Fibulin-5 is a tumour suppressor inhibiting cell migration and invasion in ovarian cancer.
26095157 2016 Fibulin-5 regulates keloid-derived fibroblast-like cells through integrin beta-1.
25909283 2015 Fibulin-5 inhibits Wnt/?-catenin signaling in lung cancer.
25891043 2015 Expression of fibulin-5 in the skin of patients with rectal prolapse.
25845228 [Diverse functions of fibulin-5 in tumors].
25807371 2015 Analysis of disease-associated protein expression using quantitative proteomics—fibulin-5 is expressed in association with hepatic fibrosis.
25792650 Gene expression levels of elastin and fibulin-5 according to differences between carotid plaque regions.
More...