Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
R01 Count 3
Funding $278,568
PubMed Score 15.85
PubTator Score 25.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (5)

PMID Text
25797253 the SLC25A10 carrier plays an important role in regulating redox homeostasis to protect confluent cells against oxidative stress.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
21555518 SLC25A10 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
16027120 Slc25a10 plays an important role in supplying malate for citrate transport required for fatty acid synthesis and its inhibition might effectively reduce lipid accumulation in adipose tissues

AA Sequence

MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCR      1 - 70
QMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRN     71 - 140
YAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAG    141 - 210
GCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKN    211 - 280
FGIKVPS                                                                   281 - 287
//

Text Mined References (22)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25797253 2015 The mitochondrial carrier SLC25A10 regulates cancer cell growth.
25416956 2014 A proteome-scale map of the human interactome network.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21437236 2011 A20 modulates lipid metabolism and energy production to promote liver regeneration.
21269460 2011 Initial characterization of the human central proteome.
More...