Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.22
PubTator Score 25.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (6)

AA Sequence

MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCR      1 - 70
QMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRN     71 - 140
YAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAG    141 - 210
GCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKN    211 - 280
FGIKVPS                                                                   281 - 287
//

Text Mined References (23)

PMID Year Title