Property Summary

NCBI Gene PubMed Count 26
PubMed Score 49.37
PubTator Score 27.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.050 6.9e-04
Breast cancer -1.200 2.6e-04
glioblastoma -1.400 4.7e-04
intraductal papillary-mucinous neoplasm ... -1.400 3.7e-03
malignant mesothelioma -2.300 4.5e-08
medulloblastoma, large-cell -1.800 3.3e-04
Multiple myeloma 1.274 3.0e-03
ovarian cancer -2.000 2.2e-07
pediatric high grade glioma -1.200 2.6e-04
primitive neuroectodermal tumor -1.300 1.0e-03
psoriasis -1.100 2.1e-59

Gene RIF (9)

AA Sequence

MAPWLQLLSLLGLLPGAVAAPAQPRAASFQAWGPPSPELLAPTRFALEMFNRGRAAGTRAVLGLVRGRVR      1 - 70
RAGQGSLYSLEATLEEPPCNDPMVCRLPVSKKTLLCSFQVLDELGRHVLLRKDCGPVDTKVPGAGEPKSA     71 - 140
FTQGSAMISSLSQNHPDNRNETFSSVISLLNEDPLSQDLPVKMASIFKNFVITYNRTYESKEEARWRLSV    141 - 210
FVNNMVRAQKIQALDRGTAQYGVTKFSDLTEEEFRTIYLNTLLRKEPGNKMKQAKSVGDLAPPEWDWRSK    211 - 280
GAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGG    281 - 350
LETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPL    351 - 420
RPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD          421 - 484
//

Text Mined References (28)

PMID Year Title