Property Summary

NCBI Gene PubMed Count 25
Grant Count 26
R01 Count 26
Funding $1,808,558.43
PubMed Score 48.36
PubTator Score 27.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.274 0.003
malignant mesothelioma -2.300 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.300 0.001
adrenocortical carcinoma -1.050 0.001
intraductal papillary-mucinous neoplasm ... -1.400 0.004
pediatric high grade glioma -1.200 0.000
inflammatory breast cancer -1.200 0.044
ovarian cancer -2.000 0.000
psoriasis -1.100 0.000

Gene RIF (8)

PMID Text
25576872 Disease-causing cathepsin-F mutants fail to cleave LIMP-2. Our findings provide evidence that LIMP-2 represents an in vivo substrate of cathepsin-F with relevance for understanding the pathophysiology of type-B-Kufs-disease.
24255036 Small hairpin RNA silencing of proteinases overexpressed in diabetic corneas enhanced corneal epithelial and stem cell marker staining and accelerated wound healing.
23297359 Homozygous and compound heterozygous missense mutations in CTSF are associated with adult-onset neuronal ceroid lipofuscinosis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16963053 data demonstrate a novel proatherogenic role for AngII, namely its ability to enhance secretion of lysosomal cathepsin F by monocyte-derived macrophages
15989693 cathepsin F, matrix metalloproteinases 11 and 12 are upregulated in cervical cancer
15184381 cathepsin F has a role in modifying low density lipoprotein particles

AA Sequence

MAPWLQLLSLLGLLPGAVAAPAQPRAASFQAWGPPSPELLAPTRFALEMFNRGRAAGTRAVLGLVRGRVR      1 - 70
RAGQGSLYSLEATLEEPPCNDPMVCRLPVSKKTLLCSFQVLDELGRHVLLRKDCGPVDTKVPGAGEPKSA     71 - 140
FTQGSAMISSLSQNHPDNRNETFSSVISLLNEDPLSQDLPVKMASIFKNFVITYNRTYESKEEARWRLSV    141 - 210
FVNNMVRAQKIQALDRGTAQYGVTKFSDLTEEEFRTIYLNTLLRKEPGNKMKQAKSVGDLAPPEWDWRSK    211 - 280
GAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGG    281 - 350
LETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPL    351 - 420
RPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD          421 - 484
//

Text Mined References (27)

PMID Year Title
25576872 2015 Lysosomal integral membrane protein type-2 (LIMP-2/SCARB2) is a substrate of cathepsin-F, a cysteine protease mutated in type-B-Kufs-disease.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24255036 2013 Enhanced wound healing, kinase and stem cell marker expression in diabetic organ-cultured human corneas upon MMP-10 and cathepsin F gene silencing.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23297359 2013 Cathepsin F mutations cause Type B Kufs disease, an adult-onset neuronal ceroid lipofuscinosis.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...