Property Summary

NCBI Gene PubMed Count 21
PubMed Score 28.97
PubTator Score 2.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.500 0.000
sonic hedgehog group medulloblastoma -1.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9UBW8 A8K9A6 Q9NVX3 Q9UJW4 SGN7a
Symbols CSN7
CSN7A
SGN7a

Gene

PDB

4D10   4D18   4WSN  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVF      1 - 70
AYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADV     71 - 140
LRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIE    141 - 210
SEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN         211 - 275
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18926707 2008 The COP9 signalosome: more than a protease.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...