Property Summary

NCBI Gene PubMed Count 23
PubMed Score 32.16
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.700 6.1e-05
psoriasis -1.500 1.3e-04
sonic hedgehog group medulloblastoma -1.100 4.1e-06

AA Sequence

MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVF      1 - 70
AYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADV     71 - 140
LRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIE    141 - 210
SEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN         211 - 275
//

Text Mined References (27)

PMID Year Title