Property Summary

NCBI Gene PubMed Count 21
Grant Count 5
R01 Count 5
Funding $474,801
PubMed Score 28.97
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.500 0.000
sonic hedgehog group medulloblastoma -1.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9UBW8 A8K9A6 Q9NVX3 Q9UJW4 SGN7a
Symbols CSN7
CSN7A
SGN7a

Gene

PDB

4D10   4D18   4WSN  

AA Sequence

MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVF      1 - 70
AYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADV     71 - 140
LRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIE    141 - 210
SEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN         211 - 275
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18926707 2008 The COP9 signalosome: more than a protease.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...