Property Summary

NCBI Gene PubMed Count 40
PubMed Score 36.33
PubTator Score 51.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 1.100 4.7e-02
Astrocytoma, Pilocytic -1.500 4.0e-10
atypical teratoid / rhabdoid tumor 1.100 9.6e-04
Breast cancer -1.300 2.9e-09
ependymoma -1.400 2.1e-14
Gaucher disease type 1 -1.200 4.0e-02
glioblastoma -1.500 6.1e-11
group 4 medulloblastoma 1.400 1.4e-03
head and neck cancer and chronic obstruc... -1.100 3.8e-02
hepatocellular carcinoma -1.500 8.2e-03
intraductal papillary-mucinous adenoma (... 1.200 2.1e-03
intraductal papillary-mucinous carcinoma... 1.600 7.0e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.1e-02
lung cancer 1.100 3.0e-04
malignant mesothelioma 1.200 3.9e-05
medulloblastoma, large-cell 1.700 3.4e-05
osteosarcoma 1.957 1.1e-06
ovarian cancer -1.900 2.9e-13
pancreatic cancer -1.100 4.2e-03
pancreatic carcinoma -1.100 4.2e-03
Pick disease 1.400 3.5e-03
primitive neuroectodermal tumor 1.500 4.6e-02
psoriasis -1.100 1.2e-05
Rheumatoid arthritis 1.400 3.7e-03
tuberculosis and treatment for 6 months 1.300 1.5e-04
Waldenstrons macroglobulinemia 1.069 5.9e-03

Gene RIF (14)

AA Sequence

MDTSSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPANPLVSRSNKFQNSSVEDDDDVVFIEPVQPPP      1 - 70
PSVPVVADQRTITFTSSKNEELQGNDSKITPSSKELASQKGSVSETIVIDDEEDMETNQGQEKNSSNFIE     71 - 140
RRPPETKNRTNDVDFSTSSFSRSKVNAGMGNSGITTEPDSEIQIANVTTLETGVSSVNDGQLENTDGRDM    141 - 210
NLMITHVTSLQNTNLGDVSNGLQSSNFGVNIQTYTPSLTSQTKTGVGPFNPGRMNVAGDVFQNGESATHH    211 - 280
NPDSWISQSASFPRNQKQPGVDSLSPVASLPKQIFQPSVQQQPTKPVKVTCANCKKPLQKGQTAYQRKGS    281 - 350
AHLFCSTTCLSSFSHKPAPKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGAL    351 - 420
NKSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGNNVLVIDGQQ    421 - 490
KRFCCQSCVSEYKQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCRTQCRFFDMTQCIGPNGYMEP    491 - 560
YCSTACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMPDGKLYNFCNSSCVAKFQALSMQSSPNGQFV    561 - 630
APSDIQLKCNYCKNSFCSKPEILEWENKVHQFCSKTCSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGVK    631 - 700
RPFCSEGCKLLYKQDFARRLGLRCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKFQDWYYKAARCDC    701 - 770
CKSQGTLKERVQWRGEMKHFCDQHCLLRFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPT    771 - 840
PNKEMKNKAVLCKPLTMTKATYCKPHMQTKSCQTDDTWRTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTV    841 - 910
PVPVPVPVFLPAPLDSSEKIPAAIEELKSKVSSDALDTELLTMTDMMSEDEGKTETTNINSVIIETDIIG    911 - 980
SDLLKNSDPETQSSMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEEYEEQPRPRSKKKGAKRKA    981 - 1050
VSGYQSHDDSSDNSECSFPFKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNY   1051 - 1120
GLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDG   1121 - 1190
SIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACL   1191 - 1260
RYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQNLNQRMDVFYLQPE   1261 - 1330
CSSSTDSPVWYTSTSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD                          1331 - 1377
//

Text Mined References (52)

PMID Year Title