Property Summary

NCBI Gene PubMed Count 9
PubMed Score 99.64
PubTator Score 24.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.400 1.6e-02
adult high grade glioma 1.100 4.0e-03
cutaneous lupus erythematosus 2.200 3.9e-04
interstitial cystitis 1.700 3.4e-03
lung cancer -1.600 1.1e-04
lung carcinoma -2.600 3.8e-27
non-small cell lung cancer -1.623 1.1e-17
osteosarcoma -3.514 9.7e-06
subependymal giant cell astrocytoma 1.418 1.2e-02
tuberculosis 1.500 2.0e-08

 GO Function (1)

Gene RIF (3)

AA Sequence

MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSA      1 - 70
VKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIA     71 - 140
KRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIF    141 - 210
QNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSNKVFVVKGLSSSSRRSLVISPPVRTATVSSPLTSPTS    211 - 280
PSTLSLKSESESVSATEDLAPDAAQGEDNSEIKELLEEEEIEKEGSEASSSEEDEPLPACNGPAQAQPSP    281 - 350
TTERAKSQEEVLPSSTTPSPGGALSPSGQPSSSATEVVLRTRTASEGSEQPKKRASIQRTSAPPSRPPPP    351 - 420
RATASPRPSSGNIPSSPTASGGGSPTSPRASLGTGTASPRTSLEVSPNPEPPEKPVRTPEAKENENIHNQ    421 - 490
NPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISANSSEGQDQLQVSMVPENNNLTAPEPQEEVSTS    491 - 560
ENPQL                                                                     561 - 565
//

Text Mined References (12)

PMID Year Title