Property Summary

NCBI Gene PubMed Count 9
Grant Count 14
R01 Count 9
Funding $1,841,160.5
PubMed Score 90.31
PubTator Score 24.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 0.000
osteosarcoma -3.514 0.000
tuberculosis 1.500 0.000
non-small cell lung cancer -1.623 0.000
lung cancer -1.600 0.000
interstitial cystitis 1.700 0.003
adult high grade glioma 1.100 0.004
subependymal giant cell astrocytoma 1.418 0.012
lung carcinoma -2.600 0.000
acute myeloid leukemia 1.400 0.016

Gene RIF (3)

PMID Text
23285027 Bin2 is a membrane-sculpting protein that influences podosome formation, motility and phagocytosis in leucocytes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
10903846 Bin2 is a BAR domain adapter protein structurally related but functionally distinct from family members Bin1 and amphiphysin.

AA Sequence

MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSA      1 - 70
VKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIA     71 - 140
KRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIF    141 - 210
QNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSNKVFVVKGLSSSSRRSLVISPPVRTATVSSPLTSPTS    211 - 280
PSTLSLKSESESVSATEDLAPDAAQGEDNSEIKELLEEEEIEKEGSEASSSEEDEPLPACNGPAQAQPSP    281 - 350
TTERAKSQEEVLPSSTTPSPGGALSPSGQPSSSATEVVLRTRTASEGSEQPKKRASIQRTSAPPSRPPPP    351 - 420
RATASPRPSSGNIPSSPTASGGGSPTSPRASLGTGTASPRTSLEVSPNPEPPEKPVRTPEAKENENIHNQ    421 - 490
NPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISANSSEGQDQLQVSMVPENNNLTAPEPQEEVSTS    491 - 560
ENPQL                                                                     561 - 565
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23285027 2012 Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis.
21782286 2011 A genome-wide association study of aging.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...