Property Summary

NCBI Gene PubMed Count 22
PubMed Score 30.45
PubTator Score 17.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.8e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 4.8e-05

Gene RIF (2)

AA Sequence

MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPG      1 - 70
MFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELK     71 - 140
QALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQAL    141 - 210
SQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTA    211 - 280
SRML                                                                      281 - 284
//

Text Mined References (24)

PMID Year Title