Property Summary

NCBI Gene PubMed Count 34
Grant Count 14
R01 Count 11
Funding $1,295,693.3
PubMed Score 34.07
PubTator Score 28.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 4.200 0.000
non primary Sjogren syndrome sicca -1.200 0.023

 MGI Term (1)

Gene RIF (22)

PMID Text
26627248 loss of endogenous WNT16 results specifically in cortical bone loss, whereas overexpression of WNT16 surprisingly increases mainly trabecular bone mass.
26584014 Data indicate that WNT16 is critical for positive regulation of both cortical and trabecular bone mass and structure. WNT16-TG mice exhibited significantly higher whole-body areal bone mineral density and bone mineral content.
26256109 Although in vitro studies demonstrated no differences in expressions of wild-type and mutant forms of IDUA and WNT16B proteins, in silico analyses predicts that WNT16 rs2707466 directly abolishes a phosphorylation site, which could cause a deleterious effect on WNT16 protein.
26254351 ALL cells expressing WNT16 are sensitive to endoplasmic reticulum stress, and show enhanced killing after addition of chloroquine.
26100275 MicroRNA-374b Suppresses Proliferation and Promotes Apoptosis in T-cell Lymphoblastic Lymphoma by Repressing AKT1 and Wnt-16
25614285 Describe TGFbeta-Wnt16-Notch signaling conduit in the chondrocyte-like transformation of VSMCs and identify endogenous TGFbeta activity in MGP-null VSMCs as a critical mediator of chondrogenesis.
25306233 Osteoblast-derived WNT16 is a previously unreported key regulator of osteoclastogenesis and fracture susceptibility.
24945404 variants at WNT16 were more strongly related to upper limb-bone mineral density, than to bone mineral density at the other sites.
24185276 Increased translation of WNT16 can thus lead to an increased inhibitory action of WNT16 on canonical WNT signaling.
24082114 Estrogen/progesterone treatment of mature myometrial cells induced expression of WNT11 and WNT16, which remained constitutively elevated in leiomyoma tissues.
More...

AA Sequence

MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSI      1 - 70
REGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCS     71 - 140
AGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGR    141 - 210
QAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIH    211 - 280
KDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYV    281 - 350
RCRRCESMTDVHTCK                                                           351 - 365
//

Text Mined References (35)

PMID Year Title
26627248 2015 The bone-sparing effects of estrogen and WNT16 are independent of each other.
26584014 2016 Osteoblast-Specific Overexpression of Human WNT16 Increases Both Cortical and Trabecular Bone Mass and Structure in Mice.
26256109 2016 Identification of IDUA and WNT16 Phosphorylation-Related Non-Synonymous Polymorphisms for Bone Mineral Density in Meta-Analyses of Genome-Wide Association Studies.
26254351 2015 WNT16-expressing Acute Lymphoblastic Leukemia Cells are Sensitive to Autophagy Inhibitors after ER Stress Induction.
26100275 2015 MicroRNA-374b Suppresses Proliferation and Promotes Apoptosis in T-cell Lymphoblastic Lymphoma by Repressing AKT1 and Wnt-16.
25614285 2015 Wnt16 attenuates TGF?-induced chondrogenic transformation in vascular smooth muscle.
25306233 2014 Osteoblast-derived WNT16 represses osteoclastogenesis and prevents cortical bone fragility fractures.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
More...