Property Summary

NCBI Gene PubMed Count 38
PubMed Score 39.65
PubTator Score 28.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 9.7e-07
non primary Sjogren syndrome sicca 891 2.3e-02
Disease Target Count Z-score Confidence
Osteoporosis 363 3.838 1.9
Disease Target Count Z-score Confidence
Osteoarthritis 184 3.17 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 4.200 9.7e-07
non primary Sjogren syndrome sicca -1.200 2.3e-02

 MGI Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (26)

AA Sequence

MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSI      1 - 70
REGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCS     71 - 140
AGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGR    141 - 210
QAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIH    211 - 280
KDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYV    281 - 350
RCRRCESMTDVHTCK                                                           351 - 365
//

Text Mined References (39)

PMID Year Title