Property Summary

NCBI Gene PubMed Count 75
PubMed Score 133.94
PubTator Score 222.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
acute myeloid leukemia 783 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Branchiootorenal syndrome 8 3.226 1.6
Branchiootic syndrome 12 3.076 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 2.7e-02

Protein-protein Interaction (9)

Gene RIF (37)

AA Sequence

MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRV      1 - 70
RYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQ     71 - 140
SKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVE    141 - 210
QLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRL    211 - 280
DDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLR    281 - 350
LDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI    351 - 420
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTL    421 - 490
LCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPV    491 - 560
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK               561 - 619
//

Text Mined References (84)

PMID Year Title