Property Summary

NCBI Gene PubMed Count 73
Grant Count 59
R01 Count 29
Funding $6,264,799.03
PubMed Score 128.79
PubTator Score 222.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 0.027

Synonym

Accession Q9UBU9 B4E269 Q99799 Q9UQL2
Symbols TAP
MEX67

Gene

PDB

1JKG   1JN5   4WYK   2Z5K   2Z5M   1FO1   1FT8   1GO5   1KOH   1KOO   1OAI   3RW6   3RW7  

Gene RIF (37)

PMID Text
25628361 Complementary structural, biochemical and cellular techniques indicated that the formation of a symmetric RNA binding platform generated by dimerization of NXF1:NXT1 facilitates the recognition of CTE-RNA and promotes its nuclear export
25360769 Hepatitis B virus core protein associates with the cellular NXF1-p15 complex via the nuclear export signal motif of hepatitis B virus core protein.Nuclear export of human hepatitis B virus core protein and pregenomic RNA depends on the NXF1-p15 machinery.
25212909 Gag polyprotein synthesis was decreased by NXF1 knockdown.
24753416 HIV-1 Rev specifically inhibits the association of TAP with spliced RRE-containing RNA and the TAP-dependent pathway reduces singly spliced and unspliced HIV-1 RNA levels
24478440 HIV-1 Rev specifically inhibits the association of TAP with spliced RRE-containing RNA and the TAP-dependent pathway reduces singly spliced and unspliced HIV-1 RNA levels
23826332 a spatial map is produced in living cells of the sites for the interaction of two TREX subunits, Alyref and Chtop, with Nxf1.
22893130 TREX is the major complex used to recruit Nxf1 to mRNA in human cells.
21965294 the organization of the NXF1 proline-tyrosine nuclear localization signal reveal unexpected redundancy in the nuclear import pathways used by NXF1.
21822283 The crystal structure of the RNA recognition and leucine-rich repeat motifs of TAP bound to one symmetrical half of the CTE RNA is solved.
21725067 The U2AF65 protein served as an adaptor to link expanded CAG RNA to NXF1 for RNA export.
More...

AA Sequence

MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRV      1 - 70
RYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQ     71 - 140
SKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVE    141 - 210
QLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRL    211 - 280
DDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLR    281 - 350
LDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI    351 - 420
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTL    421 - 490
LCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPV    491 - 560
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK               561 - 619
//

Text Mined References (82)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25628361 2015 The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
25416956 2014 A proteome-scale map of the human interactome network.
25360769 2014 Nuclear export of human hepatitis B virus core protein and pregenomic RNA depends on the cellular NXF1-p15 machinery.
25212909 2014 Gammaretroviral pol sequences act in cis to direct polysome loading and NXF1/NXT-dependent protein production by gag-encoded RNA.
23826332 2013 Mapping interactions between mRNA export factors in living cells.
23477864 2013 The lipid mediator protectin D1 inhibits influenza virus replication and improves severe influenza.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...